Product name : ROR1 Clone '1B4 antibody Isotype IgG1 Host Mouse

Catalog Number :'H00004919-M02

Quantity : 100

Price :481 Eur

Pay now with :

Supplier :ACR

ROR1 Antibody (1B4) Summary

Species Human
Tested Applications WB, ELISA, S-ELISA
Clonality Monoclonal
Host Mouse
Gene ROR1
Purity IgG purified
Guarantee Plus All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward Test in a species/application not listed above to receive a full credit towards a future purchase.

ROR1 Antibody (1B4) Details

Clone 1B4
Isotype IgG1 Kappa
Immunogen ROR1 (-, 294 a.a. ~ 393 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.ANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQ CQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTL DENFKSDLCDIPACGK

Species Reactivity

This product is reactive against Human.


Applications/Dilutions

Dilutions
Western Blot
ELISA
Sandwich ELISA
Application Notes
This antibody is useful for ELISA, Western Blot

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging, Storage & Formulations

Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer In 1x PBS, pH 7.2
Unit Size 0.1mg
Concentration Concentrations vary lot to lot. See vial label for concentration.
Preservative No Preservative
Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 6 months from date of receipt.


Bioinformatics

Gene Symbol ROR1

Alternate Names for ROR1

tyrosine-protein kinase transmembrane receptor ROR1
EC 2.7.10.1
neurotrophic tyrosine kinase receptor-related 1
Neurotrophic tyrosine kinase, receptor-related 1
NTRKR1dJ537F10.1
More


Related Products by Gene

RORA, ROR2, WNT5A, FZD9, WNT, NKX2-1, FZD1, FZD6, FZD3, EGFR, FZD2, FZD5, NOD2, AKT1, HLA-DQA1, CTLA4, RYK, SOS2, MUSK, PRCP

Background

The protein encoded by this gene is a receptor protein tyrosine kinase that modulates neurite growth in the central nervous system. It is a type I membrane protein and belongs to the ROR subfamily of cell surface receptors. Alternative splicing results in multiple transcript variants encoding different isoforms.

 

Ask Technical File!

Question about this product?

Name

Email Address

Message

Retype code:

random val Reload Image