Product name :Goat Anti-Human CD284, N-terminus

Catalog Number :129-10142

Quantity :100

Price :604 Eur

Pay now with :

Supplier :Ray Biotech


Target Name


Target Species


Species Detected

Mouse, Rat

Application Notes

Recommended Applications
Immunohistology - Paraffin, Western Blotting


This product specifically recognizes an epitope within the N-terminal (NT) region of CD284, also known as Toll-like receptor 4 (TLR4), a highly conserved member of the toll-like receptor family, expressed by peripheral blood leucocytes, activated T cells, monocytes, macrophages, dendritic cells, granulocytes and endothelial cells, which plays a primary role in the activation of innate immunity. 

CD284 acts as a receptor for bacterial lipopolysaccharides (LPS) in co-operation with CD14 and MD2 (LY96), resulting in the activation of the MyD88-dependent and MyD88-independent (TRIF-dependent) signalling pathways and the production of inflammatory cytokines. LPS-activated CD284 can also induce dendritic cell maturation via TRIF-dependent signaling. 

This product is reported as suitable for use in immunocytochemistry on acetone fixed cells.


Store at +4 °C or at -20 °C if preferred.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
If stored in this manner, this product is stable for 18 months after receipt.


Supplied as:
Purified IgG - liquid
Phosphate buffered saline
Format Type:


IgG concentration 1.0mg/ml


Antiserum to human CD284 (NT) was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.

Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminal region of Human CD284.
0.1% Sodium Azide (NaN3
0.1% Bovine Serum Albumin


Purified IgG prepared by Immunoaffinity chromatography



This product is furnished for LABORATORY RESEARCH USE ONLY. Not for diagnostic or therapeutic use.


Ask Technical File!

Question about this product?


Email Address


Retype code:

random val Reload Image

[Related Products]Goat Anti-Human CD284, N-terminus

Filter: (Type enter to validate)
  Cat_Number Product name Supplier Quantity Price Tech More
129-10142 Goat Anti-Human CD284, N-terminus Ray Biotech 100 604 129-10142 Goat Anti-Human CD284, N-terminus Ray Biotech 100 604€
126-10001 Goat Anti-Human XPNPEP1, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10001 Goat Anti-Human XPNPEP1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10002 Goat Anti-Human UXT, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10002 Goat Anti-Human UXT, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10004 Goat Anti-Human Tyrosine Hydroxylase, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10004 Goat Anti-Human Tyrosine Hydroxylase, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
126-10009 Goat Anti-Human TRPC6 (C-term), (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10009 Goat Anti-Human TRPC6 (C-term), (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10020 Goat Anti-Human SUR1 ABCC8, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10020 Goat Anti-Human SUR1 ABCC8, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10031 Goat Anti-Human SEPT2, (N terminus) Antibodies Ray Biotech 100 μg 353 126-10031 Goat Anti-Human SEPT2, (N terminus) Antibodies Ray Biotech 100 μg 353€
126-10035 Goat Anti-Human RGS13, (N Terminus) Antibodies Ray Biotech 100 μg 353 126-10035 Goat Anti-Human RGS13, (N Terminus) Antibodies Ray Biotech 100 μg 353€
126-10040 Goat Anti-Human PTGER3 EP3, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10040 Goat Anti-Human PTGER3 EP3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10041 Goat Anti-Human, Mouse PSPH, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10041 Goat Anti-Human, Mouse PSPH, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10046 Goat Anti-Human PPP4C, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10046 Goat Anti-Human PPP4C, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10047 Goat Anti-Human, Mouse, Rat PPP2R4 PP2A, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10047 Goat Anti-Human, Mouse, Rat PPP2R4 PP2A, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10049 Goat Anti-Human PMSCL1, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10049 Goat Anti-Human PMSCL1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10057 Goat Anti-Human OXTR , (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10057 Goat Anti-Human OXTR , (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10071 Goat Anti-Human MBNL1 , (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10071 Goat Anti-Human MBNL1 , (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10075 Goat Anti-Human LMP7, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10075 Goat Anti-Human LMP7, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10082 Goat Anti-Human KRT13 , (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10082 Goat Anti-Human KRT13 , (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10083 Goat Anti-Human KCNQ1, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10083 Goat Anti-Human KCNQ1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10094 Goat Anti-Human HMGB3 HMG4, (internal region (near C Terminus)) Antibodies Ray Biotech 100 μg 353 126-10094 Goat Anti-Human HMGB3 HMG4, (internal region (near C Terminus)) Antibodies Ray Biotech 100 μg 353€
126-10096 Goat Anti-Human HIP14L ZDHHC13, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10096 Goat Anti-Human HIP14L ZDHHC13, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10111 Goat Anti-Human FTH1, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10111 Goat Anti-Human FTH1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10113 Goat Anti-Human FKBP4 FKBP52, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10113 Goat Anti-Human FKBP4 FKBP52, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10114 Goat Anti-Human, Mouse, Rat FHL3 SLIM2, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10114 Goat Anti-Human, Mouse, Rat FHL3 SLIM2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10116 Goat Anti-Human F2R PAR1, (Internal region (near N Terminus)) Antibodies Ray Biotech 100 μg 353 126-10116 Goat Anti-Human F2R PAR1, (Internal region (near N Terminus)) Antibodies Ray Biotech 100 μg 353€
126-10118 Goat Anti-Human ERP29 , (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10118 Goat Anti-Human ERP29 , (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10120 Goat Anti-Human ERCC1, (N Terminus) Antibodies Ray Biotech 100 μg 353 126-10120 Goat Anti-Human ERCC1, (N Terminus) Antibodies Ray Biotech 100 μg 353€
126-10129 Goat Anti-Human DPM1, (N Terminus) Antibodies Ray Biotech 100 μg 353 126-10129 Goat Anti-Human DPM1, (N Terminus) Antibodies Ray Biotech 100 μg 353€
126-10133 Goat Anti-Human, Mouse, Rat Desmin, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10133 Goat Anti-Human, Mouse, Rat Desmin, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10134 Goat Anti-Human DAPP1, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10134 Goat Anti-Human DAPP1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10152 Goat Anti-Human CDK10 PISSLRE, (N Terminus) Antibodies Ray Biotech 100 μg 353 126-10152 Goat Anti-Human CDK10 PISSLRE, (N Terminus) Antibodies Ray Biotech 100 μg 353€
126-10153 Goat Anti-Human CD20 MS4A1 (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10153 Goat Anti-Human CD20 MS4A1 (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10156 Goat Anti-Human, Mouse, Rat CAV3 , (N Terminus) Antibodies Ray Biotech 100 μg 353 126-10156 Goat Anti-Human, Mouse, Rat CAV3 , (N Terminus) Antibodies Ray Biotech 100 μg 353€
126-10158 Goat Anti-Human CAMK1D, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10158 Goat Anti-Human CAMK1D, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10159 Goat Anti-Human C1D, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10159 Goat Anti-Human C1D, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10170 Goat Anti-Human APOL5, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10170 Goat Anti-Human APOL5, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10171 Goat Anti-Human APOL3, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10171 Goat Anti-Human APOL3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10172 Goat Anti-Human APOL2, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10172 Goat Anti-Human APOL2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10173 Goat Anti-Human APOL1, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10173 Goat Anti-Human APOL1, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
126-10174 Goat Anti-Human APOBEC3G, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10174 Goat Anti-Human APOBEC3G, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10175 Goat Anti-Human APOBEC3C (C-term), (C terminus) Antibodies Ray Biotech 100 μg 353 126-10175 Goat Anti-Human APOBEC3C (C-term), (C terminus) Antibodies Ray Biotech 100 μg 353€
126-10177 Goat Anti-Human APOA5, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10177 Goat Anti-Human APOA5, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10178 Goat Anti-Human, Mouse, Rat Annexin I, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10178 Goat Anti-Human, Mouse, Rat Annexin I, (C Terminus) Antibodies Ray Biotech 100 μg 353€
129-10110 Goat Anti-Human CD192, N-terminus Ray Biotech 100 604 129-10110 Goat Anti-Human CD192, N-terminus Ray Biotech 100 604€
129-10113 Goat Anti-Human CD195, N-terminus Ray Biotech 100 604 129-10113 Goat Anti-Human CD195, N-terminus Ray Biotech 100 604€
129-10183 Goat Anti-Human CDw198, N-terminus Ray Biotech 100 604 129-10183 Goat Anti-Human CDw198, N-terminus Ray Biotech 100 604€
129-10473 Goat Anti-Human NALP3, C-terminus Ray Biotech 50 843 129-10473 Goat Anti-Human NALP3, C-terminus Ray Biotech 50 843€
129-10482 Goat Anti-Human Neurexin 1, C-terminus Ray Biotech 100 717 129-10482 Goat Anti-Human Neurexin 1, C-terminus Ray Biotech 100 717€ Pub
129-10515 Goat Anti-Human pan-Alcohol Dehydrogenase, N-terminus Ray Biotech 100 717 129-10515 Goat Anti-Human pan-Alcohol Dehydrogenase, N-terminus Ray Biotech 100 717€
129-10578 Goat Anti-Human RAB8A, C-terminus Ray Biotech 100 717 129-10578 Goat Anti-Human RAB8A, C-terminus Ray Biotech 100 717€
ER-14-0064 Goat Anti-Human 4E-T EIF4ENIF1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0064 Goat Anti-Human 4E-T EIF4ENIF1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0070 Goat Anti-Human ABCB9 TAPL, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0070 Goat Anti-Human ABCB9 TAPL, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0071 Goat Anti-Human, Rat ABCC4 MRP4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0071 Goat Anti-Human, Rat ABCC4 MRP4, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0073 Goat Anti-Human ABCE1 RNAse L inhibitor, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0073 Goat Anti-Human ABCE1 RNAse L inhibitor, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0078 Goat Anti-Human ACADM, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0078 Goat Anti-Human ACADM, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0079 Goat Anti-Human ACHE, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0079 Goat Anti-Human ACHE, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0080 Goat Anti-Human ACOX2, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0080 Goat Anti-Human ACOX2, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0083 Goat Anti-Human ACSL5, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0083 Goat Anti-Human ACSL5, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0084 Goat Anti-Human, Mouse, Rat, Pig Smooth muscle alpha-actin, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0084 Goat Anti-Human, Mouse, Rat, Pig Smooth muscle alpha-actin, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0087 Goat Anti-Human Activin receptor-like kinase 1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0087 Goat Anti-Human Activin receptor-like kinase 1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0089 Goat Anti-Human Acylglycerol kinase, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0089 Goat Anti-Human Acylglycerol kinase, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0091 Goat Anti-Human ADAM12, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0091 Goat Anti-Human ADAM12, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0095 Goat Anti-Human Adenosine A2b Receptor, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0095 Goat Anti-Human Adenosine A2b Receptor, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0107 Goat Anti-Human AIBZIP CREB3L4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0107 Goat Anti-Human AIBZIP CREB3L4, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0108 Goat Anti-Human AID, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0108 Goat Anti-Human AID, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0111 Goat Anti-Human AIF1 IBA1 (isoforms 1 + 3), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0111 Goat Anti-Human AIF1 IBA1 (isoforms 1 + 3), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0116 Goat Anti-Human AIRE (isoforms 1 and 2), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0116 Goat Anti-Human AIRE (isoforms 1 and 2), (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0120 Goat Anti-Human AKAP3 SOB1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0120 Goat Anti-Human AKAP3 SOB1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0122 Goat Anti-Human AKAP8 AKAP95, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0122 Goat Anti-Human AKAP8 AKAP95, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0123 Goat Anti-Human AKAP9 AKAP450 CG-NAP, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0123 Goat Anti-Human AKAP9 AKAP450 CG-NAP, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0124 Goat Anti-Human AKR1B10, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0124 Goat Anti-Human AKR1B10, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0126 Goat Anti-Human AKR1C4, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0126 Goat Anti-Human AKR1C4, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0127 Goat Anti-Human Aldehyde Reductase, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0127 Goat Anti-Human Aldehyde Reductase, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0128 Goat Anti-Human, Mouse, Rat ALDH1A1 (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0128 Goat Anti-Human, Mouse, Rat ALDH1A1 (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0130 Goat Anti-Human, Mouse CSN2 TRIP15, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0130 Goat Anti-Human, Mouse CSN2 TRIP15, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0131 Goat Anti-Human ALMS1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0131 Goat Anti-Human ALMS1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0133 Goat Anti-Human ALS2CR1 NIF3L1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0133 Goat Anti-Human ALS2CR1 NIF3L1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0134 Goat Anti-Human ALS2CR2 ILPIP, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0134 Goat Anti-Human ALS2CR2 ILPIP, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0136 Goat Anti-Human Alsin ALS2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0136 Goat Anti-Human Alsin ALS2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0139 Goat Anti-Human Amisyn STXBP6, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0139 Goat Anti-Human Amisyn STXBP6, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0144 Goat Anti-Human ANILLIN Scraps (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0144 Goat Anti-Human ANILLIN Scraps (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0146 Goat Anti-Human Annexin A10 Annexin 14, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0146 Goat Anti-Human Annexin A10 Annexin 14, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0147 Goat Anti-Human Annexin A11, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0147 Goat Anti-Human Annexin A11, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0149 Goat Anti-Human AOC3, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0149 Goat Anti-Human AOC3, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353€
ER-14-0150 Goat Anti-Human AP-2 gamma, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0150 Goat Anti-Human AP-2 gamma, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0152 Goat Anti-Human, Mouse APBB1 FE65, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0152 Goat Anti-Human, Mouse APBB1 FE65, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0154 Goat Anti-Human APOA4, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0154 Goat Anti-Human APOA4, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0159 Goat Anti-Human APOC1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0159 Goat Anti-Human APOC1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0160 Goat Anti-Human APOE, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0160 Goat Anti-Human APOE, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0162 Goat Anti-Human APOM, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0162 Goat Anti-Human APOM, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0165 Goat Anti-Human, Rat Arachidonate 5-lipoxygenase, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0165 Goat Anti-Human, Rat Arachidonate 5-lipoxygenase, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0166 Goat Anti-Human ARF1, 2, 3, 4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0166 Goat Anti-Human ARF1, 2, 3, 4, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0168 Goat Anti-Human, Mouse Arginase, type 1 ARG1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0168 Goat Anti-Human, Mouse Arginase, type 1 ARG1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0171 Goat Anti-Human ARHGEF4, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0171 Goat Anti-Human ARHGEF4, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0173 Goat Anti-Human ARIH1 HHARI, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0173 Goat Anti-Human ARIH1 HHARI, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0174 Goat Anti-Human, Mouse ARIH2 TRIAD1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0174 Goat Anti-Human, Mouse ARIH2 TRIAD1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0175 Goat Anti-Human ARL2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0175 Goat Anti-Human ARL2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0176 Goat Anti-Human ARL4A, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0176 Goat Anti-Human ARL4A, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0178 Goat Anti-Human, Rat ARNO cytohesin 2, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0178 Goat Anti-Human, Rat ARNO cytohesin 2, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0180 Goat Anti-Human ARP1 homolog A, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0180 Goat Anti-Human ARP1 homolog A, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0181 Goat Anti-Human ARP1 homolog B, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0181 Goat Anti-Human ARP1 homolog B, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0182 Goat Anti-Human ARP2 3 subunit 1B, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0182 Goat Anti-Human ARP2 3 subunit 1B, (N Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0184 Goat Anti-Human, Mouse ARPC3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0184 Goat Anti-Human, Mouse ARPC3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0190 Goat Anti-Human ASF1A, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0190 Goat Anti-Human ASF1A, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0196 Goat Anti-Human, Mouse ATF4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0196 Goat Anti-Human, Mouse ATF4, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0198 Goat Anti-Human ATF7, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0198 Goat Anti-Human ATF7, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0202 Goat Anti-Human, Mouse, Rat ATP6IP2 Renin receptor, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0202 Goat Anti-Human, Mouse, Rat ATP6IP2 Renin receptor, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0204 Goat Anti-Human AVPR1B, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0204 Goat Anti-Human AVPR1B, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0206 Goat Anti-Human AXIN1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0206 Goat Anti-Human AXIN1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0208 Goat Anti-Human B5 Receptor PCID1 EIF3M, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0208 Goat Anti-Human B5 Receptor PCID1 EIF3M, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0209 Goat Anti-Human B56 beta isoform, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0209 Goat Anti-Human B56 beta isoform, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0211 Goat Anti-Human BAF53A and BAF53B, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0211 Goat Anti-Human BAF53A and BAF53B, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0212 Goat Anti-Human BAF57 SMARCE1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0212 Goat Anti-Human BAF57 SMARCE1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0213 Goat Anti-Human BAG2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0213 Goat Anti-Human BAG2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0214 Goat Anti-Human BAG3 BIS CAIR1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0214 Goat Anti-Human BAG3 BIS CAIR1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0217 Goat Anti-Human BAG5 (N Terminus), (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0217 Goat Anti-Human BAG5 (N Terminus), (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0218 Goat Anti-Human BAIAP2 (isoform 1), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0218 Goat Anti-Human BAIAP2 (isoform 1), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0219 Goat Anti-Human BAIAP2 (isoform 2), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0219 Goat Anti-Human BAIAP2 (isoform 2), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0220 Goat Anti-Human BAIAP2 (isoform 3), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0220 Goat Anti-Human BAIAP2 (isoform 3), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0221 Goat Anti-Human BAP SIL1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0221 Goat Anti-Human BAP SIL1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0223 Goat Anti-Human BAZ2B, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0223 Goat Anti-Human BAZ2B, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0224 Goat Anti-Human BCAP31 BAP31, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0224 Goat Anti-Human BCAP31 BAP31, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0226 Goat Anti-Human BCL7A, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0226 Goat Anti-Human BCL7A, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0232 Goat Anti-Human, Mouse, Rat BHMT, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0232 Goat Anti-Human, Mouse, Rat BHMT, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0234 Goat Anti-Human BIM (AD ACD ABCD isoforms), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0234 Goat Anti-Human BIM (AD ACD ABCD isoforms), (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0238 Goat Anti-Human Bisphosphate 3'-nucleotidase, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0238 Goat Anti-Human Bisphosphate 3'-nucleotidase, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0244 Goat Anti-Human BOULE BOLL, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0244 Goat Anti-Human BOULE BOLL, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0245 Goat Anti-Human BPOZ ABTB1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0245 Goat Anti-Human BPOZ ABTB1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0249 Goat Anti-Human BRF2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0249 Goat Anti-Human BRF2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0251 Goat Anti-Human Bruno-like 5, (internal region (near the N Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0251 Goat Anti-Human Bruno-like 5, (internal region (near the N Terminus)) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0252 Goat Anti-Human BS69 ZMYND11, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0252 Goat Anti-Human BS69 ZMYND11, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0258 Goat Anti-Human CABP1, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0258 Goat Anti-Human CABP1, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0260 Goat Anti-Human CACNB4 (C terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0260 Goat Anti-Human CACNB4 (C terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0261 Goat Anti-Human CACNB4 (internal), (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0261 Goat Anti-Human CACNB4 (internal), (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353€
ER-14-0262 Goat Anti-Human CADM4 (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0262 Goat Anti-Human CADM4 (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0266 Goat Anti-Human Cannabinoid Receptor 2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0266 Goat Anti-Human Cannabinoid Receptor 2, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0267 Goat Anti-Human CAPON NOS1AP, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0267 Goat Anti-Human CAPON NOS1AP, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0269 Goat Anti-Human, Rat CAPZB, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0269 Goat Anti-Human, Rat CAPZB, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0271 Goat Anti-Human CARD11, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0271 Goat Anti-Human CARD11, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0273 Goat Anti-Human CARD6, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0273 Goat Anti-Human CARD6, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0278 Goat Anti-Human Cathepsin F, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0278 Goat Anti-Human Cathepsin F, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0279 Goat Anti-Human Cathepsin K, (internal region (near N Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0279 Goat Anti-Human Cathepsin K, (internal region (near N Terminus)) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0280 Goat Anti-Human CBR1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0280 Goat Anti-Human CBR1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0281 Goat Anti-Human CBR3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0281 Goat Anti-Human CBR3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0294 Goat Anti-Human CD274 PD-L1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0294 Goat Anti-Human CD274 PD-L1, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0295 Goat Anti-Human CD2BP2 (N Terminus), (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0295 Goat Anti-Human CD2BP2 (N Terminus), (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0296 Goat Anti-Human CD32 FCGR2B, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0296 Goat Anti-Human CD32 FCGR2B, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0298 Goat Anti-Human Cdc42-binding kinase alpha, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0298 Goat Anti-Human Cdc42-binding kinase alpha, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0299 Goat Anti-Human CDCP1 (isoform 1: C term), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0299 Goat Anti-Human CDCP1 (isoform 1: C term), (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0304 Goat Anti-Human CDYL, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0304 Goat Anti-Human CDYL, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0306 Goat Anti-Human, Mouse CENTA1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0306 Goat Anti-Human, Mouse CENTA1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0307 Goat Anti-Human CENTA2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0307 Goat Anti-Human CENTA2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0308 Goat Anti-Human CENTB1 ACAP1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0308 Goat Anti-Human CENTB1 ACAP1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0309 Goat Anti-Human CENTB2 ACAP2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0309 Goat Anti-Human CENTB2 ACAP2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0312 Goat Anti-Human ARAP3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0312 Goat Anti-Human ARAP3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0314 Goat Anti-Human CENTG3 MRIP1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0314 Goat Anti-Human CENTG3 MRIP1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0318 Goat Anti-Human CES1, (internal region (near C terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0318 Goat Anti-Human CES1, (internal region (near C terminus)) Antibodies Ray Biotech 100 μg 353€
ER-14-0328 Goat Anti-Human CHFR, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0328 Goat Anti-Human CHFR, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0329 Goat Anti-Human CHMP5, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0329 Goat Anti-Human CHMP5, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0330 Goat Anti-Human M1 mAChR CHRM1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0330 Goat Anti-Human M1 mAChR CHRM1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0334 Goat Anti-Human CIAS1 cryopyrin ( C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0334 Goat Anti-Human CIAS1 cryopyrin ( C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0342 Goat Anti-Human, Mouse CLIC4, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0342 Goat Anti-Human, Mouse CLIC4, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0343 Goat Anti-Human Clik1 STK35, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0343 Goat Anti-Human Clik1 STK35, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0344 Goat Anti-Human CLIM1 PDLIM1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0344 Goat Anti-Human CLIM1 PDLIM1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0345 Goat Anti-Human CLLD8 SETDB2, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0345 Goat Anti-Human CLLD8 SETDB2, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0347 Goat Anti-Human CLPP, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0347 Goat Anti-Human CLPP, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0348 Goat Anti-Human Clusterin APOJ, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0348 Goat Anti-Human Clusterin APOJ, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0349 Goat Anti-Human, Rat CMG1 CCDC2 IFT74, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0349 Goat Anti-Human, Rat CMG1 CCDC2 IFT74, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0357 Goat Anti-Human COMT (N Terminus), (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0357 Goat Anti-Human COMT (N Terminus), (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0361 Goat Anti-Humann Mouse Coronin 1 TACO, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0361 Goat Anti-Humann Mouse Coronin 1 TACO, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0362 Goat Anti-Human Coronin 3 coronin 1C, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0362 Goat Anti-Human Coronin 3 coronin 1C, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0364 Goat Anti-Human COX4I1 & COX4I2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0364 Goat Anti-Human COX4I1 & COX4I2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0365 Goat Anti-Human CPEB1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0365 Goat Anti-Human CPEB1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0367 Goat Anti-Human CPT1B (isoform 1), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0367 Goat Anti-Human CPT1B (isoform 1), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0369 Goat Anti-Human CREM, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0369 Goat Anti-Human CREM, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0374 Goat Anti-Human, Mouse, Rat CSK, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0374 Goat Anti-Human, Mouse, Rat CSK, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0376 Goat Anti-Human CSNK1E, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0376 Goat Anti-Human CSNK1E, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0379 Goat Anti-Human CYB561D2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0379 Goat Anti-Human CYB561D2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0380 Goat Anti-Human CYBR PSCDBP, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0380 Goat Anti-Human CYBR PSCDBP, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0390 Goat Anti-Human Cystatin B Stefin B, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0390 Goat Anti-Human Cystatin B Stefin B, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0393 Goat Anti-Human, Mouse Cytochrome b reductase 1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0393 Goat Anti-Human, Mouse Cytochrome b reductase 1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0397 Goat Anti-Human DAP10 HCST, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0397 Goat Anti-Human DAP10 HCST, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0398 Goat Anti-Human DAP3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0398 Goat Anti-Human DAP3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0405 Goat Anti-Human DCP1A, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0405 Goat Anti-Human DCP1A, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0406 Goat Anti-Human DDAH1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0406 Goat Anti-Human DDAH1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0407 Goat Anti-Human, Mouse DDAH2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0407 Goat Anti-Human, Mouse DDAH2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0408 Goat Anti-Human DDX5 p68 RNA helicase, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0408 Goat Anti-Human DDX5 p68 RNA helicase, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0409 Goat Anti-Human DEAD-box protein 6, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0409 Goat Anti-Human DEAD-box protein 6, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0413 Goat Anti-Human DGAT2, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0413 Goat Anti-Human DGAT2, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353€
ER-14-0416 Goat Anti-Human Dicarbonyl Reductase, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0416 Goat Anti-Human Dicarbonyl Reductase, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0420 Goat Anti-Human Dispatched homolog 1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0420 Goat Anti-Human Dispatched homolog 1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0422 Goat Anti-Human DKK2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0422 Goat Anti-Human DKK2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0423 Goat Anti-Human DKK3 REIC, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0423 Goat Anti-Human DKK3 REIC, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0424 Goat Anti-Human DKK4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0424 Goat Anti-Human DKK4, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0425 Goat Anti-Human DLC1 (Isoforms 1 and 3), (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0425 Goat Anti-Human DLC1 (Isoforms 1 and 3), (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0428 Goat Anti-Human DOCK1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0428 Goat Anti-Human DOCK1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0429 Goat Anti-Human DOK3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0429 Goat Anti-Human DOK3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0430 Goat Anti-Human DOK5, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0430 Goat Anti-Human DOK5, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0431 Goat Anti-Human DOPA decarboxylase, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0431 Goat Anti-Human DOPA decarboxylase, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0442 Goat Anti-Human Duffy FY DARC, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0442 Goat Anti-Human Duffy FY DARC, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0443 Goat Anti-Human, Mouse, Rat DUSP1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0443 Goat Anti-Human, Mouse, Rat DUSP1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0444 Goat Anti-Human DUSP10 MKP5, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0444 Goat Anti-Human DUSP10 MKP5, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0446 Goat Anti-Human DUSP16, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0446 Goat Anti-Human DUSP16, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0447 Goat Anti-Human DUSP8 HVH5, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0447 Goat Anti-Human DUSP8 HVH5, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0448 Goat Anti-Human, Mouse Dynactin, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0448 Goat Anti-Human, Mouse Dynactin, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0450 Goat Anti-Human Dysadherin, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0450 Goat Anti-Human Dysadherin, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0451 Goat Anti-Human DYX1C1 (Isoform a), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0451 Goat Anti-Human DYX1C1 (Isoform a), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0452 Goat Anti-Human E2-230K UBE2O, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0452 Goat Anti-Human E2-230K UBE2O, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0455 Goat Anti-Human EBAG9 RCAS1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0455 Goat Anti-Human EBAG9 RCAS1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0457 Goat Anti-Human ECT2, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0457 Goat Anti-Human ECT2, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0458 Goat Anti-Human, Rat, Mouse, Rabbit EDD1 HYD, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0458 Goat Anti-Human, Rat, Mouse, Rabbit EDD1 HYD, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0463 Goat Anti-Human EHD2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0463 Goat Anti-Human EHD2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0466 Goat Anti-Human ELF1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0466 Goat Anti-Human ELF1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0468 Goat Anti-Human ELF3 ERT ESX, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0468 Goat Anti-Human ELF3 ERT ESX, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0469 Goat Anti-Human ELF5, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0469 Goat Anti-Human ELF5, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0471 Goat Anti-Human, Cow, Zebrafish ELMO1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0471 Goat Anti-Human, Cow, Zebrafish ELMO1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0472 Goat Anti-Human ELMO2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0472 Goat Anti-Human ELMO2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0473 Goat Anti-Human ELMO3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0473 Goat Anti-Human ELMO3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0477 Goat Anti-Human EndoPDI TXNDC5, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0477 Goat Anti-Human EndoPDI TXNDC5, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0480 Goat Anti-Human ENPP1 PC1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0480 Goat Anti-Human ENPP1 PC1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0485 Goat Anti-Human EPB41L3 DAL1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0485 Goat Anti-Human EPB41L3 DAL1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0492 Goat Anti-Human ERG, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0492 Goat Anti-Human ERG, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0496 Goat Anti-Human ETEA UBXD8, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0496 Goat Anti-Human ETEA UBXD8, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0498 Goat Anti-Human EVC2 Limbin, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0498 Goat Anti-Human EVC2 Limbin, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0502 Goat Anti-Human EZH1, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0502 Goat Anti-Human EZH1, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0504 Goat Anti-Human FABP2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0504 Goat Anti-Human FABP2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0505 Goat Anti-Human FACE1 ZMPSTE24, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0505 Goat Anti-Human FACE1 ZMPSTE24, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0506 Goat Anti-Human FACL4 ACSL4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0506 Goat Anti-Human FACL4 ACSL4, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0512 Goat Anti-Human FANCG XRCC9, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0512 Goat Anti-Human FANCG XRCC9, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0513 Goat Anti-Human FAPP2 PLEKHA8, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0513 Goat Anti-Human FAPP2 PLEKHA8, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0516 Goat Anti-Human FAZF TZFP ZBTB32, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0516 Goat Anti-Human FAZF TZFP ZBTB32, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0518 Goat Anti-Human FBL2 FBXL2, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0518 Goat Anti-Human FBL2 FBXL2, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0521 Goat Anti-Human FBXL10 PCCX2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0521 Goat Anti-Human FBXL10 PCCX2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0523 Goat Anti-Human FBXL12, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0523 Goat Anti-Human FBXL12, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0524 Goat Anti-Human FBXL3, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0524 Goat Anti-Human FBXL3, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0531 Goat Anti-Human, Mouse, Rat FBXW2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0531 Goat Anti-Human, Mouse, Rat FBXW2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0534 Goat Anti-Human FENS1 WDFY1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0534 Goat Anti-Human FENS1 WDFY1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0538 Goat Anti-Human FGFR1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0538 Goat Anti-Human FGFR1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0541 Goat Anti-Human, Mouse FHL2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0541 Goat Anti-Human, Mouse FHL2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0545 Goat Anti-Human Fibulin 5 FBLN5, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0545 Goat Anti-Human Fibulin 5 FBLN5, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353€
ER-14-0546 Goat Anti-Human FLAP ALOX5AP (C Term), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0546 Goat Anti-Human FLAP ALOX5AP (C Term), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0549 Goat Anti-Human Flotillin 1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0549 Goat Anti-Human Flotillin 1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0550 Goat Anti-Human Flotillin 2 FLOT2 (C Term), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0550 Goat Anti-Human Flotillin 2 FLOT2 (C Term), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0551 Goat Anti-Human FLVCR, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0551 Goat Anti-Human FLVCR, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0553 Goat Anti-Human, Mouse FOXA1 HNF3A, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0553 Goat Anti-Human, Mouse FOXA1 HNF3A, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0554 Goat Anti-Human FOXA2 HNF3B, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0554 Goat Anti-Human FOXA2 HNF3B, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0557 Goat Anti-Human, Mouse, Zebrafish FOXC1 (C Term), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0557 Goat Anti-Human, Mouse, Zebrafish FOXC1 (C Term), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0559 Goat Anti-Human FOXC2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0559 Goat Anti-Human FOXC2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0562 Goat Anti-Human FOXE1 TTF2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0562 Goat Anti-Human FOXE1 TTF2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0569 Goat Anti-Human FOXK2 ILF (isoform 1), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0569 Goat Anti-Human FOXK2 ILF (isoform 1), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0571 Goat Anti-Human FOXL2 BPES, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0571 Goat Anti-Human FOXL2 BPES, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0573 Goat Anti-Human FOXN1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0573 Goat Anti-Human FOXN1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0578 Goat Anti-Human, Mouse FOXP2 (C terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0578 Goat Anti-Human, Mouse FOXP2 (C terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0580 Goat Anti-Human FOXP3 Scurfin (Mouse), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0580 Goat Anti-Human FOXP3 Scurfin (Mouse), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0582 Goat Anti-Human FOXQ1 FKHRL1, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0582 Goat Anti-Human FOXQ1 FKHRL1, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0587 Goat Anti-Human FRAT2 GSK-3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0587 Goat Anti-Human FRAT2 GSK-3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0589 Goat Anti-Human Frizzled 7, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0589 Goat Anti-Human Frizzled 7, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0591 Goat Anti-Human FSTL1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0591 Goat Anti-Human FSTL1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0595 Goat Anti-Human, Mouse FYN, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0595 Goat Anti-Human, Mouse FYN, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0596 Goat Anti-Human FZD8 frizzled 8, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0596 Goat Anti-Human FZD8 frizzled 8, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0597 Goat Anti-Human FZD9, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0597 Goat Anti-Human FZD9, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0600 Goat Anti-Human GAB2, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0600 Goat Anti-Human GAB2, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353€
ER-14-0606 Goat Anti-Human Galanin Receptor 3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0606 Goat Anti-Human Galanin Receptor 3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0609 Goat Anti-Human GALR1 (C Term), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0609 Goat Anti-Human GALR1 (C Term), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0616 Goat Anti-Human GCIP MAID, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0616 Goat Anti-Human GCIP MAID, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0617 Goat Anti-Human, Mouse GCIP-interacting protein p29, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0617 Goat Anti-Human, Mouse GCIP-interacting protein p29, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0620 Goat Anti-Human GCNT3 (aa 410 to 422), (internal region (near C terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0620 Goat Anti-Human GCNT3 (aa 410 to 422), (internal region (near C terminus)) Antibodies Ray Biotech 100 μg 353€
ER-14-0621 Goat Anti-Human GDF15, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0621 Goat Anti-Human GDF15, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0625 Goat Anti-Human GERP TRIM8, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0625 Goat Anti-Human GERP TRIM8, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0626 Goat Anti-Human, Mouse GFAP, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0626 Goat Anti-Human, Mouse GFAP, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0628 Goat Anti-Human, Rat Ghrelin preproprotein, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0628 Goat Anti-Human, Rat Ghrelin preproprotein, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0630 Goat Anti-Human GIPC3, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0630 Goat Anti-Human GIPC3, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0631 Goat Anti-Human GIRK2 KCNJ6, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0631 Goat Anti-Human GIRK2 KCNJ6, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0638 Goat Anti-Human GLuR5 GRIK1, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0638 Goat Anti-Human GLuR5 GRIK1, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353€
ER-14-0644 Goat Anti-Human GNIP TRIM7, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0644 Goat Anti-Human GNIP TRIM7, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0646 Goat Anti-Human GOLGA3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0646 Goat Anti-Human GOLGA3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0648 Goat Anti-Human GOLPH2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0648 Goat Anti-Human GOLPH2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0653 Goat Anti-Human GPR119, (C Terminus (near)) Antibodies Ray Biotech 100 μg 353 ER-14-0653 Goat Anti-Human GPR119, (C Terminus (near)) Antibodies Ray Biotech 100 μg 353€
ER-14-0656 Goat Anti-Human GPR40, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0656 Goat Anti-Human GPR40, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0659 Goat Anti-Human GPS1 COPS1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0659 Goat Anti-Human GPS1 COPS1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0662 Goat Anti-Human GPX4 (Isoform a and c), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0662 Goat Anti-Human GPX4 (Isoform a and c), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0665 Goat Anti-Human GRAF ARHGAP26, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0665 Goat Anti-Human GRAF ARHGAP26, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0666 Goat Anti-Human GRAP, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0666 Goat Anti-Human GRAP, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0667 Goat Anti-Human GRAP2 GRID Grf40, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0667 Goat Anti-Human GRAP2 GRID Grf40, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0669 Goat Anti-Human GRB7 (N Terminus), (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0669 Goat Anti-Human GRB7 (N Terminus), (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0675 Goat Anti-Human GSTM1 GSTM2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0675 Goat Anti-Human GSTM1 GSTM2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0683 Goat Anti-Human Hamartin TSC1 (isoform 1), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0683 Goat Anti-Human Hamartin TSC1 (isoform 1), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0691 Goat Anti-Human HEXIM1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0691 Goat Anti-Human HEXIM1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0692 Goat Anti-Human, Mouse HIP14 ZDHHC17, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0692 Goat Anti-Human, Mouse HIP14 ZDHHC17, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0693 Goat Anti-Human HIP2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0693 Goat Anti-Human HIP2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0694 Goat Anti-Human, Mouse HIP-55 SH3P7, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0694 Goat Anti-Human, Mouse HIP-55 SH3P7, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0695 Goat Anti-Human Histamine Receptor H1 (C Term), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0695 Goat Anti-Human Histamine Receptor H1 (C Term), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0699 Goat Anti-Human, Rat HMG20A, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0699 Goat Anti-Human, Rat HMG20A, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0702 Goat Anti-Human HNF4A, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0702 Goat Anti-Human HNF4A, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0704 Goat Anti-Human Homeobox B13, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0704 Goat Anti-Human Homeobox B13, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0725 Goat Anti-Human ICAM5 precursor, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0725 Goat Anti-Human ICAM5 precursor, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0731 Goat Anti-Human, Mouse IFT88 Polaris, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0731 Goat Anti-Human, Mouse IFT88 Polaris, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0732 Goat Anti-Human IGF2BP2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0732 Goat Anti-Human IGF2BP2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0734 Goat Anti-Human IGFBP4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0734 Goat Anti-Human IGFBP4, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0741 Goat Anti-Human INADL PATJ, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0741 Goat Anti-Human INADL PATJ, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0743 Goat Anti-Human ING2 ING1L, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0743 Goat Anti-Human ING2 ING1L, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0745 Goat Anti-Human, Mouse Integrin beta 5, (C Terminus) Antibodies Ray Biotech 100 μg 257 ER-14-0745 Goat Anti-Human, Mouse Integrin beta 5, (C Terminus) Antibodies Ray Biotech 100 μg 257€
ER-14-0749 Goat Anti-Human, Mouse IRF2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0749 Goat Anti-Human, Mouse IRF2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0750 Goat Anti-Human IRF6, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0750 Goat Anti-Human IRF6, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0753 Goat Anti-Human ITK, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0753 Goat Anti-Human ITK, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0758 Goat Anti-Human, Mouse Kalirin (isoform 2), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0758 Goat Anti-Human, Mouse Kalirin (isoform 2), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0760 Goat Anti-Human Karyopherin (importin) beta 1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0760 Goat Anti-Human Karyopherin (importin) beta 1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0766 Goat Anti-Human KCNC3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0766 Goat Anti-Human KCNC3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0767 Goat Anti-Human KCNJ11 KATP , (internal region (near the N Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0767 Goat Anti-Human KCNJ11 KATP , (internal region (near the N Terminus)) Antibodies Ray Biotech 100 μg 353€
ER-14-0768 Goat Anti-Human Kcnj11 Kir6.2, (internal region (near the N Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0768 Goat Anti-Human Kcnj11 Kir6.2, (internal region (near the N Terminus)) Antibodies Ray Biotech 100 μg 353€
ER-14-0770 Goat Anti-Human KIF4A, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0770 Goat Anti-Human KIF4A, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0772 Goat Anti-Human, Dog Kinesin 1 UKHC, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0772 Goat Anti-Human, Dog Kinesin 1 UKHC, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0774 Goat Anti-Human, Mouse KLF1 EKLF, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0774 Goat Anti-Human, Mouse KLF1 EKLF, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0775 Goat Anti-Human KLF15, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0775 Goat Anti-Human KLF15, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0776 Goat Anti-Human KLF16 DRRF, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0776 Goat Anti-Human KLF16 DRRF, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0777 Goat Anti-Human KLF3 BKLF, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0777 Goat Anti-Human KLF3 BKLF, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0778 Goat Anti-Human KLF4 GKLF, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0778 Goat Anti-Human KLF4 GKLF, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0783 Goat Anti-Human KPNA1 Importin alpha 5, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0783 Goat Anti-Human KPNA1 Importin alpha 5, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0784 Goat Anti-Human KPNA2 IPOA1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0784 Goat Anti-Human KPNA2 IPOA1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0785 Goat Anti-Human, Mouse, Rat KPNA3 IPOA4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0785 Goat Anti-Human, Mouse, Rat KPNA3 IPOA4, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0786 Goat Anti-Human, Mouse KPNA4 IPOA3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0786 Goat Anti-Human, Mouse KPNA4 IPOA3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0789 Goat Anti-Human KU70 XRCC6, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0789 Goat Anti-Human KU70 XRCC6, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0796 Goat Anti-Human LASP1 (N Terminus), (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0796 Goat Anti-Human LASP1 (N Terminus), (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0798 Goat Anti-Human, Mouse, Rat Latexin, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0798 Goat Anti-Human, Mouse, Rat Latexin, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0805 Goat Anti-Human LHX2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0805 Goat Anti-Human LHX2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0815 Goat Anti-Human, Rat LIS1 PAFAH1B1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0815 Goat Anti-Human, Rat LIS1 PAFAH1B1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0819 Goat Anti-Human LNK SH2B3, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0819 Goat Anti-Human LNK SH2B3, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0824 Goat Anti-Human LRRK2 PARK8 (near C Terminus), (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0824 Goat Anti-Human LRRK2 PARK8 (near C Terminus), (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353€
ER-14-0825 Goat Anti-Human LXR beta NR1H2, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0825 Goat Anti-Human LXR beta NR1H2, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0830 Goat Anti-Human MAD2L1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0830 Goat Anti-Human MAD2L1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0831 Goat Anti-Human MAD3 MXD3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0831 Goat Anti-Human MAD3 MXD3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0832 Goat Anti-Human MAD4 MXD4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0832 Goat Anti-Human MAD4 MXD4, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0833 Goat Anti-Human MAGOH, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0833 Goat Anti-Human MAGOH, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0835 Goat Anti-Human MAML1 Mastermind, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0835 Goat Anti-Human MAML1 Mastermind, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0848 Goat Anti-Human MARK4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0848 Goat Anti-Human MARK4, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0850 Goat Anti-Human MBL2 Mannan-Binding Lectin, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0850 Goat Anti-Human MBL2 Mannan-Binding Lectin, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0851 Goat Anti-Human MC2R ACTHR, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0851 Goat Anti-Human MC2R ACTHR, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0853 Goat Anti-Human, Mouse, Rat MCL1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0853 Goat Anti-Human, Mouse, Rat MCL1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0854 Goat Anti-Human MDA5 IFIH1, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0854 Goat Anti-Human MDA5 IFIH1, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0857 Goat Anti-Human MDG1 DNAJB9, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0857 Goat Anti-Human MDG1 DNAJB9, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0860 Goat Anti-Human MEL18 PCGF2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0860 Goat Anti-Human MEL18 PCGF2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0861 Goat Anti-Human Melanocortin 3 Receptor, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0861 Goat Anti-Human Melanocortin 3 Receptor, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0867 Goat Anti-Mouse, Human MID2 TRIM1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0867 Goat Anti-Mouse, Human MID2 TRIM1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0868 Goat Anti-Human MIF, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0868 Goat Anti-Human MIF, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0870 Goat Anti-Human MLL2, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0870 Goat Anti-Human MLL2, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0871 Goat Anti-Human MLL4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0871 Goat Anti-Human MLL4, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0872 Goat Anti-Human MMP7, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0872 Goat Anti-Human MMP7, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0874 Goat Anti-Human MOG, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0874 Goat Anti-Human MOG, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0876 Goat Anti-Human Monoglyceride Lipase, (internal region (near N Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0876 Goat Anti-Human Monoglyceride Lipase, (internal region (near N Terminus)) Antibodies Ray Biotech 100 μg 353€
ER-14-0878 Goat Anti-Human MPG, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0878 Goat Anti-Human MPG, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0879 Goat Anti-Human MPS1 RPS27, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0879 Goat Anti-Human MPS1 RPS27, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0881 Goat Anti-Human MRGX, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0881 Goat Anti-Human MRGX, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0882 Goat Anti-Human MRP5, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0882 Goat Anti-Human MRP5, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0883 Goat Anti-Human MRPL3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0883 Goat Anti-Human MRPL3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0889 Goat Anti-Human MSX1, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0889 Goat Anti-Human MSX1, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0890 Goat Anti-Human MTA1, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0890 Goat Anti-Human MTA1, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353€
ER-14-0891 Goat Anti-Human MTHFD2L, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0891 Goat Anti-Human MTHFD2L, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0892 Goat Anti-Human MTM1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0892 Goat Anti-Human MTM1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0896 Goat Anti-Human MTR, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0896 Goat Anti-Human MTR, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0898 Goat Anti-Human Munc13-4 UNC13D (C terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0898 Goat Anti-Human Munc13-4 UNC13D (C terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0900 Goat Anti-Human, Mouse MUNC18 STXBP1 (isoform a), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0900 Goat Anti-Human, Mouse MUNC18 STXBP1 (isoform a), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0902 Goat Anti-Human MURF1 TRIM63 (N Term), (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0902 Goat Anti-Human MURF1 TRIM63 (N Term), (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0903 Goat Anti-Human MURF2 TRIM55, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0903 Goat Anti-Human MURF2 TRIM55, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0904 Goat Anti-Human MURF3 TRIM54, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0904 Goat Anti-Human MURF3 TRIM54, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0905 Goat Anti-Human MUTYH, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0905 Goat Anti-Human MUTYH, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0911 Goat Anti-Human MYRIP SLAC2C, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0911 Goat Anti-Human MYRIP SLAC2C, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0914 Goat Anti-Human NANOG (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0914 Goat Anti-Human NANOG (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0915 Goat Anti-Human NANOS1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0915 Goat Anti-Human NANOS1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0917 Goat Anti-Human NAT10 hALP, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0917 Goat Anti-Human NAT10 hALP, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353€
ER-14-0923 Goat Anti-Human NDRG1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0923 Goat Anti-Human NDRG1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0927 Goat Anti-Human NEIL1 NEH1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0927 Goat Anti-Human NEIL1 NEH1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0930 Goat Anti-Human NET1 ARHGEF8 (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0930 Goat Anti-Human NET1 ARHGEF8 (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0934 Goat Anti-Human, Mouse, Rat Neuregulin 3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0934 Goat Anti-Human, Mouse, Rat Neuregulin 3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0935 Goat Anti-Human Neurexin 1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0935 Goat Anti-Human Neurexin 1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0936 Goat Anti-Human, Mouse Neurobeachin, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0936 Goat Anti-Human, Mouse Neurobeachin, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0939 Goat Anti-Human Neuro-d4 DPF1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0939 Goat Anti-Human Neuro-d4 DPF1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0947 Goat Anti-Human Neuroserpin, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0947 Goat Anti-Human Neuroserpin, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0948 Goat Anti-Human, Mouse Neurturin, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0948 Goat Anti-Human, Mouse Neurturin, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0950 Goat Anti-Human NFATC4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0950 Goat Anti-Human NFATC4, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0951 Goat Anti-Human NFIL3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0951 Goat Anti-Human NFIL3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0954 Goat Anti-Human NIPP1 PPP1R8, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0954 Goat Anti-Human NIPP1 PPP1R8, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0955 Goat Anti-Human NIR1 PITPNM3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0955 Goat Anti-Human NIR1 PITPNM3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0961 Goat Anti-Human, Mouse NONO p54NRB, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0961 Goat Anti-Human, Mouse NONO p54NRB, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0965 Goat Anti-Human NOXO1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0965 Goat Anti-Human NOXO1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0966 Goat Anti-Human Npap60 Nup50, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0966 Goat Anti-Human Npap60 Nup50, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0969 Goat Anti-Human, Mouse, Dog NQO1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0969 Goat Anti-Human, Mouse, Dog NQO1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0972 Goat Anti-Human, Mouse, Rat Nucleophosmin NPM1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0972 Goat Anti-Human, Mouse, Rat Nucleophosmin NPM1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0973 Goat Anti-Human, Mouse NUMB, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0973 Goat Anti-Human, Mouse NUMB, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0977 Goat Anti-Human OASIS CREB3L1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0977 Goat Anti-Human OASIS CREB3L1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0978 Goat Anti-Human OCT4 POU5F1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0978 Goat Anti-Human OCT4 POU5F1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0984 Goat Anti-Human OIP106 TRAK1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0984 Goat Anti-Human OIP106 TRAK1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0989 Goat Anti-Human ORC3L, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0989 Goat Anti-Human ORC3L, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0990 Goat Anti-Human, Mouse ORC4L, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0990 Goat Anti-Human, Mouse ORC4L, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0992 Goat Anti-Human Orexin Receptor 2, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0992 Goat Anti-Human Orexin Receptor 2, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0993 Goat Anti-Human ORP1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0993 Goat Anti-Human ORP1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0994 Goat Anti-Human ORP11 OSBPL11, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0994 Goat Anti-Human ORP11 OSBPL11, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0995 Goat Anti-Human ORP2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0995 Goat Anti-Human ORP2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0997 Goat Anti-Human ORP5 (OBPH1), (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0997 Goat Anti-Human ORP5 (OBPH1), (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0999 Goat Anti-Human ORP9 OSBPL9, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0999 Goat Anti-Human ORP9 OSBPL9, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1022 Goat Anti-Human pan ADH, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1022 Goat Anti-Human pan ADH, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1027 Goat Anti-Human PARK7 DJ-1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1027 Goat Anti-Human PARK7 DJ-1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1033 Goat Anti-Human PAX3, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1033 Goat Anti-Human PAX3, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1034 Goat Anti-Human PAX5 BSAP, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1034 Goat Anti-Human PAX5 BSAP, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1038 Goat Anti-Human PAX8 (N Terminus), (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1038 Goat Anti-Human PAX8 (N Terminus), (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1039 Goat Anti-Human PCBP4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1039 Goat Anti-Human PCBP4, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1047 Goat Anti-Human, Mouse PDE4D, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1047 Goat Anti-Human, Mouse PDE4D, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1049 Goat Anti-Human PDE5A, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1049 Goat Anti-Human PDE5A, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1052 Goat Anti-Human PDLIM4 RIL, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1052 Goat Anti-Human PDLIM4 RIL, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1054 Goat Anti-Human, Rat PEBP1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1054 Goat Anti-Human, Rat PEBP1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1062 Goat Anti-Human Perilipin (internal), (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-1062 Goat Anti-Human Perilipin (internal), (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353€
ER-14-1063 Goat Anti-Human, Mouse Peroxiredoxin 2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1063 Goat Anti-Human, Mouse Peroxiredoxin 2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1064 Goat Anti-Human PERP, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1064 Goat Anti-Human PERP, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1069 Goat Anti-Human PGRMC1 MPR, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1069 Goat Anti-Human PGRMC1 MPR, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1074 Goat Anti-Human PHLDA2 IPL, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1074 Goat Anti-Human PHLDA2 IPL, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1075 Goat Anti-Human PHLDA3 TIH1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1075 Goat Anti-Human PHLDA3 TIH1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1076 Goat Anti-Human PHLPP2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1076 Goat Anti-Human PHLPP2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1081 Goat Anti-Human PI31 PSMF1 (Isoform 1), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1081 Goat Anti-Human PI31 PSMF1 (Isoform 1), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1085 Goat Anti-Human PIK3C2A, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1085 Goat Anti-Human PIK3C2A, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1091 Goat Anti-Human PINX1, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1091 Goat Anti-Human PINX1, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1092 Goat Anti-Human PIR51 RAD51AP1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1092 Goat Anti-Human PIR51 RAD51AP1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1093 Goat Anti-Human Pirin, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1093 Goat Anti-Human Pirin, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1094 Goat Anti-Human PIST FIG GOPC, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1094 Goat Anti-Human PIST FIG GOPC, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1101 Goat Anti-Human Plakoglobin Gamma-catenin, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1101 Goat Anti-Human Plakoglobin Gamma-catenin, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1102 Goat Anti-Human Pleckstrin, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1102 Goat Anti-Human Pleckstrin, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1109 Goat Anti-Human, Mouse, Rat PODXL, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1109 Goat Anti-Human, Mouse, Rat PODXL, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1111 Goat Anti-Human, Rat PPAR delta (Isoform 1), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1111 Goat Anti-Human, Rat PPAR delta (Isoform 1), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1113 Goat Anti-Human, Mouse PPP1R15A GADD34, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1113 Goat Anti-Human, Mouse PPP1R15A GADD34, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1114 Goat Anti-Human PPP2CA PPP2CB, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1114 Goat Anti-Human PPP2CA PPP2CB, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1116 Goat Anti-Human PPP2R5A, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1116 Goat Anti-Human PPP2R5A, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1117 Goat Anti-Human PPP2R5D, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1117 Goat Anti-Human PPP2R5D, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1119 Goat Anti-Human PRAM1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1119 Goat Anti-Human PRAM1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1121 Goat Anti-Human PRDM11, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1121 Goat Anti-Human PRDM11, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1123 Goat Anti-Human, Mouse PRDM4 PFM1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1123 Goat Anti-Human, Mouse PRDM4 PFM1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1126 Goat Anti-Human Prefoldin, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1126 Goat Anti-Human Prefoldin, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1131 Goat Anti-Human PRL1 PTP4A1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1131 Goat Anti-Human PRL1 PTP4A1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1145 Goat Anti-Human PSME1 (isoform 1), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1145 Goat Anti-Human PSME1 (isoform 1), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1146 Goat Anti-Human PSME2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1146 Goat Anti-Human PSME2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1147 Goat Anti-Human PSME3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1147 Goat Anti-Human PSME3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1150 Goat Anti-Human PTBP1 PTB, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1150 Goat Anti-Human PTBP1 PTB, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1152 Goat Anti-Human PTCH (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1152 Goat Anti-Human PTCH (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1156 Goat Anti-Human PTP4A1 PRL-1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1156 Goat Anti-Human PTP4A1 PRL-1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1169 Goat Anti-Human RAB2 RAB2A, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1169 Goat Anti-Human RAB2 RAB2A, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1170 Goat Anti-Human RAB8A, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1170 Goat Anti-Human RAB8A, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1171 Goat Anti-Human Rabenosyn 5, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1171 Goat Anti-Human Rabenosyn 5, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1173 Goat Anti-Human RACGAP1 MgcRacGAP, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1173 Goat Anti-Human RACGAP1 MgcRacGAP, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1174 Goat Anti-Human RAD51C, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1174 Goat Anti-Human RAD51C, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1177 Goat Anti-Human RAD9A, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1177 Goat Anti-Human RAD9A, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1179 Goat Anti-Human RAE1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1179 Goat Anti-Human RAE1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1181 Goat Anti-Human RANBP16 Exportin 7, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1181 Goat Anti-Human RANBP16 Exportin 7, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1182 Goat Anti-Human RANBP7 Importin 7, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1182 Goat Anti-Human RANBP7 Importin 7, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1183 Goat Anti-Human RANBP8 IPO8, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1183 Goat Anti-Human RANBP8 IPO8, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1184 Goat Anti-Human RANBPM RANBP9, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1184 Goat Anti-Human RANBPM RANBP9, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1187 Goat Anti-Human RARA, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1187 Goat Anti-Human RARA, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1190 Goat Anti-Human RASAL, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1190 Goat Anti-Human RASAL, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1206 Goat Anti-Human REV1L, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1206 Goat Anti-Human REV1L, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1211 Goat Anti-Human RGS1 1R20, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1211 Goat Anti-Human RGS1 1R20, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1212 Goat Anti-Human RGS14, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1212 Goat Anti-Human RGS14, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1214 Goat Anti-Human RGS18, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1214 Goat Anti-Human RGS18, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1220 Goat Anti-Human Ribosomal protein L22, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1220 Goat Anti-Human Ribosomal protein L22, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1222 Goat Anti-Human RIC8A Synembryn, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1222 Goat Anti-Human RIC8A Synembryn, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1223 Goat Anti-Human RICTOR, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1223 Goat Anti-Human RICTOR, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1225 Goat Anti-Human RIG DKK3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1225 Goat Anti-Human RIG DKK3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1229 Goat Anti-Human RNF13 RZF (isoform 1 and 3), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1229 Goat Anti-Human RNF13 RZF (isoform 1 and 3), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1230 Goat Anti-Human RNF2 dinG, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1230 Goat Anti-Human RNF2 dinG, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1231 Goat Anti-Human RNF213 C17orf27 (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1231 Goat Anti-Human RNF213 C17orf27 (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1235 Goat Anti-Human RNF3 (247 aa isoform), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1235 Goat Anti-Human RNF3 (247 aa isoform), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1236 Goat Anti-Human RNF31 ZIBRA (C terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1236 Goat Anti-Human RNF31 ZIBRA (C terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1239 Goat Anti-Human RNF34 RFI (N Terminus), (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1239 Goat Anti-Human RNF34 RFI (N Terminus), (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1240 Goat Anti-Human RNF35 TRIM40, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1240 Goat Anti-Human RNF35 TRIM40, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1241 Goat Anti-Human, Mouse RNF36 TRIM69, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1241 Goat Anti-Human, Mouse RNF36 TRIM69, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1242 Goat Anti-Human RNF39 LIRF, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1242 Goat Anti-Human RNF39 LIRF, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1245 Goat Anti-Human RNF8, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1245 Goat Anti-Human RNF8, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1251 Goat Anti-Human MST4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1251 Goat Anti-Human MST4, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1254 Goat Anti-Human RPL17, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1254 Goat Anti-Human RPL17, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1258 Goat Anti-Human S100A4 CAPL, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1258 Goat Anti-Human S100A4 CAPL, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1260 Goat Anti-Human SAE1 AOS1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1260 Goat Anti-Human SAE1 AOS1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1262 Goat Anti-Human Sak STK18 PLK4, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1262 Goat Anti-Human Sak STK18 PLK4, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1265 Goat Anti-Human SAMSN1, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1265 Goat Anti-Human SAMSN1, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1266 Goat Anti-Human SAP130 SF3B3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1266 Goat Anti-Human SAP130 SF3B3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1268 Goat Anti-Human SART1, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1268 Goat Anti-Human SART1, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1269 Goat Anti-Human SART3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1269 Goat Anti-Human SART3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1271 Goat Anti-Human SCAP2 PRAP, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1271 Goat Anti-Human SCAP2 PRAP, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1276 Goat Anti-Human SDHB, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1276 Goat Anti-Human SDHB, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1278 Goat Anti-Human SEMA3E, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1278 Goat Anti-Human SEMA3E, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1285 Goat Anti-Human Septin 3, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1285 Goat Anti-Human Septin 3, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1287 Goat Anti-Human Serotonin receptor 1B HTR1B, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1287 Goat Anti-Human Serotonin receptor 1B HTR1B, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1292 Goat Anti-Human SET I2 alpha PP2A, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1292 Goat Anti-Human SET I2 alpha PP2A, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1293 Goat Anti-Human SETMAR, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1293 Goat Anti-Human SETMAR, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1294 Goat Anti-Human SF3B4 SAP49, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1294 Goat Anti-Human SF3B4 SAP49, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1295 Goat Anti-Human SFRP2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1295 Goat Anti-Human SFRP2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1299 Goat Anti-Human SH3BP1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1299 Goat Anti-Human SH3BP1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1301 Goat Anti-Human, Mouse SHP2 PTPN11, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1301 Goat Anti-Human, Mouse SHP2 PTPN11, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1302 Goat Anti-Human, Rat SIAH1, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1302 Goat Anti-Human, Rat SIAH1, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1303 Goat Anti-Human SIAHBP1 FIR, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1303 Goat Anti-Human SIAHBP1 FIR, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1306 Goat Anti-Human Silver homologue Pmel 17, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1306 Goat Anti-Human Silver homologue Pmel 17, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1309 Goat Anti-Human SIRT3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1309 Goat Anti-Human SIRT3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1310 Goat Anti-Human, Rat SIRT4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1310 Goat Anti-Human, Rat SIRT4, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1312 Goat Anti-Human SLC16A7 MCT2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1312 Goat Anti-Human SLC16A7 MCT2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1322 Goat Anti-Human SMARCA3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1322 Goat Anti-Human SMARCA3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1326 Goat Anti-Human SMO (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1326 Goat Anti-Human SMO (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-1328 Goat Anti-Human SMUG1, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-1328 Goat Anti-Human SMUG1, (N Terminus) Antibodies Ray Biotech 100 μg 353€
  Cat_Number Product name Supplier Quantity Price PDF Pub