Product name :Goat Anti-Human TLR5

Catalog Number :129-10647

Quantity :100

Price :604 Eur

Pay now with :

Supplier :Ray Biotech


Target Name


Target Species


Application Notes

Recommended Applications
ELISA (dilution: , 1/100), Flow Cytometry, Immunohistology - Paraffin, Western Blotting


This product specifically recognizes human Toll-like receptor 5 (TLR5), a member of the evolutionarily conserved Toll-like receptor family, highly expressed by peripheral blood leukocytes, and in particular monocytes, which signals through the adaptor proteins MyD88 and TRAF6, inducing the activation of the transcription factor NF-kappaB.

TLR5 plays an important role in the innate immune response to pathogenic bacteria, through the recognition of the protein monomer flagellin, which upregulates TLR5 expression.

This product is reported as suitable for use in immunocytochemistry.


Store at -20 °C only.
Storage in frost-free freezers is not recommended.
This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
If stored in this manner, this product is stable for 18 months after receipt.


Supplied as:
Purified IgG - liquid
Phosphate buffered saline
Format Type:


IgG concentration 1.0mg/ml


Antiserum to human TLRS was raised by repeated immunisation of goats with highly purified antigen. Purified IgG was prepared by affinity chromatography.

Synthetic peptide DLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ corresponding to amino acids 151-181 of human TLR5.
0.09% Sodium Azide (NaN3
0.1% Bovine Serum Albumin


Purified IgG prepared by Immunoaffinity chromatography



This product is furnished for LABORATORY RESEARCH USE ONLY. Not for diagnostic or therapeutic use.


Ask Technical File!

Question about this product?


Email Address


Retype code:

random val Reload Image

[Related Products]Goat Anti-Human TLR5

Filter: (Type enter to validate)
  Cat_Number Product name Supplier Quantity Price Tech More
129-10647 Goat Anti-Human TLR5 Ray Biotech 100 604 129-10647 Goat Anti-Human TLR5 Ray Biotech 100 604€
126-10001 Goat Anti-Human XPNPEP1, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10001 Goat Anti-Human XPNPEP1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10002 Goat Anti-Human UXT, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10002 Goat Anti-Human UXT, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10004 Goat Anti-Human Tyrosine Hydroxylase, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10004 Goat Anti-Human Tyrosine Hydroxylase, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
126-10009 Goat Anti-Human TRPC6 (C-term), (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10009 Goat Anti-Human TRPC6 (C-term), (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10019 Goat Anti-Human Synaptotagmin I, (internal region) Antibodies Ray Biotech 100 μg 353 126-10019 Goat Anti-Human Synaptotagmin I, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10020 Goat Anti-Human SUR1 ABCC8, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10020 Goat Anti-Human SUR1 ABCC8, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10021 Goat Anti-Human STK39 SPAK, (internal region) Antibodies Ray Biotech 100 μg 353 126-10021 Goat Anti-Human STK39 SPAK, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10023 Goat Anti-Human SPHK1, (internal region) Antibodies Ray Biotech 100 μg 353 126-10023 Goat Anti-Human SPHK1, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10024 Goat Anti-Human SODD, (internal region) Antibodies Ray Biotech 100 μg 353 126-10024 Goat Anti-Human SODD, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10027 Goat Anti-Human SIGLEC8, (internal region) Antibodies Ray Biotech 100 μg 353 126-10027 Goat Anti-Human SIGLEC8, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10028 Goat Anti-Human SH2D4A, (internal region) Antibodies Ray Biotech 100 μg 353 126-10028 Goat Anti-Human SH2D4A, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10029 Goat Anti-Human SEPT7, (internal region) Antibodies Ray Biotech 100 μg 353 126-10029 Goat Anti-Human SEPT7, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10030 Goat Anti-Human SEPT6, (internal region) Antibodies Ray Biotech 100 μg 353 126-10030 Goat Anti-Human SEPT6, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10031 Goat Anti-Human SEPT2, (N terminus) Antibodies Ray Biotech 100 μg 353 126-10031 Goat Anti-Human SEPT2, (N terminus) Antibodies Ray Biotech 100 μg 353€
126-10034 Goat Anti-Human S100A9, (internal region) Antibodies Ray Biotech 100 μg 353 126-10034 Goat Anti-Human S100A9, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10035 Goat Anti-Human RGS13, (N Terminus) Antibodies Ray Biotech 100 μg 353 126-10035 Goat Anti-Human RGS13, (N Terminus) Antibodies Ray Biotech 100 μg 353€
126-10036 Goat Anti-Human RABIF, (internal region) Antibodies Ray Biotech 100 μg 353 126-10036 Goat Anti-Human RABIF, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10038 Goat Anti-Human PXR NR1I2, (internal region) Antibodies Ray Biotech 100 μg 353 126-10038 Goat Anti-Human PXR NR1I2, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10039 Goat Anti-Human PU.1, (internal region) Antibodies Ray Biotech 100 μg 353 126-10039 Goat Anti-Human PU.1, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10040 Goat Anti-Human PTGER3 EP3, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10040 Goat Anti-Human PTGER3 EP3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10041 Goat Anti-Human, Mouse PSPH, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10041 Goat Anti-Human, Mouse PSPH, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10045 Goat Anti-Human PRDX1, (internal region) Antibodies Ray Biotech 100 μg 353 126-10045 Goat Anti-Human PRDX1, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10046 Goat Anti-Human PPP4C, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10046 Goat Anti-Human PPP4C, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10047 Goat Anti-Human, Mouse, Rat PPP2R4 PP2A, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10047 Goat Anti-Human, Mouse, Rat PPP2R4 PP2A, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10048 Goat Anti-Human PON1 paraoxonase 1, (internal region) Antibodies Ray Biotech 100 μg 353 126-10048 Goat Anti-Human PON1 paraoxonase 1, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10049 Goat Anti-Human PMSCL1, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10049 Goat Anti-Human PMSCL1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10053 Goat Anti-Human PCQAP MED15 , (internal region) Antibodies Ray Biotech 100 μg 353 126-10053 Goat Anti-Human PCQAP MED15 , (internal region) Antibodies Ray Biotech 100 μg 353€
126-10057 Goat Anti-Human OXTR , (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10057 Goat Anti-Human OXTR , (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10059 Goat Anti-Human ORAI1 CRACM1, (internal region) Antibodies Ray Biotech 100 μg 353 126-10059 Goat Anti-Human ORAI1 CRACM1, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10064 Goat Anti-Human NDEL1, (internal region) Antibodies Ray Biotech 100 μg 353 126-10064 Goat Anti-Human NDEL1, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10068 Goat Anti-Human MTHFD1, (internal region) Antibodies Ray Biotech 100 μg 353 126-10068 Goat Anti-Human MTHFD1, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10069 Goat Anti-Human MEIS1 , (internal region) Antibodies Ray Biotech 100 μg 353 126-10069 Goat Anti-Human MEIS1 , (internal region) Antibodies Ray Biotech 100 μg 353€
126-10070 Goat Anti-Human MECL1, (internal region) Antibodies Ray Biotech 100 μg 353 126-10070 Goat Anti-Human MECL1, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10071 Goat Anti-Human MBNL1 , (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10071 Goat Anti-Human MBNL1 , (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10073 Goat Anti-Human LTF, (internal region) Antibodies Ray Biotech 100 μg 353 126-10073 Goat Anti-Human LTF, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10074 Goat Anti-Human LRP4 LRP10, (internal region) Antibodies Ray Biotech 100 μg 353 126-10074 Goat Anti-Human LRP4 LRP10, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10075 Goat Anti-Human LMP7, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10075 Goat Anti-Human LMP7, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10076 Goat Anti-Human LIP1 LKB1IP, (internal region) Antibodies Ray Biotech 100 μg 353 126-10076 Goat Anti-Human LIP1 LKB1IP, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10077 Goat Anti-Human LIMP2 SCARB2, (internal region) Antibodies Ray Biotech 100 μg 353 126-10077 Goat Anti-Human LIMP2 SCARB2, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10080 Goat Anti-Human LASS1, (internal region) Antibodies Ray Biotech 100 μg 353 126-10080 Goat Anti-Human LASS1, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10081 Goat Anti-Human Laforin (isoform a), (internal region) Antibodies Ray Biotech 100 μg 353 126-10081 Goat Anti-Human Laforin (isoform a), (internal region) Antibodies Ray Biotech 100 μg 353€
126-10082 Goat Anti-Human KRT13 , (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10082 Goat Anti-Human KRT13 , (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10083 Goat Anti-Human KCNQ1, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10083 Goat Anti-Human KCNQ1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10085 Goat Anti-Human JUNB, (internal region) Antibodies Ray Biotech 100 μg 353 126-10085 Goat Anti-Human JUNB, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10086 Goat Anti-Human IMPDH2, (internal region) Antibodies Ray Biotech 100 μg 353 126-10086 Goat Anti-Human IMPDH2, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10087 Goat Anti-Human IL18, (internal region) Antibodies Ray Biotech 100 μg 353 126-10087 Goat Anti-Human IL18, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10088 Goat Anti-Human IKZF1 IKAROS, (internal region) Antibodies Ray Biotech 100 μg 353 126-10088 Goat Anti-Human IKZF1 IKAROS, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10089 Goat Anti-Human IDS, (internal region) Antibodies Ray Biotech 100 μg 353 126-10089 Goat Anti-Human IDS, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10092 Goat Anti-Human HOXD10, (internal region) Antibodies Ray Biotech 100 μg 353 126-10092 Goat Anti-Human HOXD10, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10094 Goat Anti-Human HMGB3 HMG4, (internal region (near C Terminus)) Antibodies Ray Biotech 100 μg 353 126-10094 Goat Anti-Human HMGB3 HMG4, (internal region (near C Terminus)) Antibodies Ray Biotech 100 μg 353€
126-10095 Goat Anti-Human, Mouse HIPPI, (internal region) Antibodies Ray Biotech 100 μg 353 126-10095 Goat Anti-Human, Mouse HIPPI, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10096 Goat Anti-Human HIP14L ZDHHC13, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10096 Goat Anti-Human HIP14L ZDHHC13, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10098 Goat Anti-Human HAX1, (internal region) Antibodies Ray Biotech 100 μg 353 126-10098 Goat Anti-Human HAX1, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10099 Goat Anti-Human GRM7, (internal region) Antibodies Ray Biotech 100 μg 353 126-10099 Goat Anti-Human GRM7, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10100 Goat Anti-Human GRIA4, (internal region) Antibodies Ray Biotech 100 μg 353 126-10100 Goat Anti-Human GRIA4, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10101 Goat Anti-Human Granulin GRN, (internal region) Antibodies Ray Biotech 100 μg 353 126-10101 Goat Anti-Human Granulin GRN, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10102 Goat Anti-Human GPR81 FKSG80, (Internal region) Antibodies Ray Biotech 100 μg 353 126-10102 Goat Anti-Human GPR81 FKSG80, (Internal region) Antibodies Ray Biotech 100 μg 353€
126-10106 Goat Anti-Human GABRB3, (internal region) Antibodies Ray Biotech 100 μg 353 126-10106 Goat Anti-Human GABRB3, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10108 Goat Anti-Human GABRA4, (internal region) Antibodies Ray Biotech 100 μg 353 126-10108 Goat Anti-Human GABRA4, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10109 Goat Anti-Human FTO (Mouse), (Internal region) Antibodies Ray Biotech 100 μg 353 126-10109 Goat Anti-Human FTO (Mouse), (Internal region) Antibodies Ray Biotech 100 μg 353€
126-10111 Goat Anti-Human FTH1, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10111 Goat Anti-Human FTH1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10112 Goat Anti-Human FMR1 (aa116-130), (internal region) Antibodies Ray Biotech 100 μg 353 126-10112 Goat Anti-Human FMR1 (aa116-130), (internal region) Antibodies Ray Biotech 100 μg 353€
126-10113 Goat Anti-Human FKBP4 FKBP52, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10113 Goat Anti-Human FKBP4 FKBP52, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10114 Goat Anti-Human, Mouse, Rat FHL3 SLIM2, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10114 Goat Anti-Human, Mouse, Rat FHL3 SLIM2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10115 Goat Anti-Human FGFR2, (internal region) Antibodies Ray Biotech 100 μg 353 126-10115 Goat Anti-Human FGFR2, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10116 Goat Anti-Human F2R PAR1, (Internal region (near N Terminus)) Antibodies Ray Biotech 100 μg 353 126-10116 Goat Anti-Human F2R PAR1, (Internal region (near N Terminus)) Antibodies Ray Biotech 100 μg 353€
126-10117 Goat Anti-Human EWS EWSR1, (internal region) Antibodies Ray Biotech 100 μg 353 126-10117 Goat Anti-Human EWS EWSR1, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10118 Goat Anti-Human ERP29 , (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10118 Goat Anti-Human ERP29 , (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10119 Goat Anti-Human ERN1 IRE1a, (internal region) Antibodies Ray Biotech 100 μg 353 126-10119 Goat Anti-Human ERN1 IRE1a, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10120 Goat Anti-Human ERCC1, (N Terminus) Antibodies Ray Biotech 100 μg 353 126-10120 Goat Anti-Human ERCC1, (N Terminus) Antibodies Ray Biotech 100 μg 353€
126-10122 Goat Anti-Human Endothelial lipase, (internal region) Antibodies Ray Biotech 100 μg 353 126-10122 Goat Anti-Human Endothelial lipase, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10124 Goat Anti-Human, Mouse EBF1 COE1, (internal region) Antibodies Ray Biotech 100 μg 353 126-10124 Goat Anti-Human, Mouse EBF1 COE1, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10125 Goat Anti-Human E2F7, (internal region) Antibodies Ray Biotech 100 μg 353 126-10125 Goat Anti-Human E2F7, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10126 Goat Anti-Human DRAK2, (internal region) Antibodies Ray Biotech 100 μg 353 126-10126 Goat Anti-Human DRAK2, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10129 Goat Anti-Human DPM1, (N Terminus) Antibodies Ray Biotech 100 μg 353 126-10129 Goat Anti-Human DPM1, (N Terminus) Antibodies Ray Biotech 100 μg 353€
126-10130 Goat Anti-Human DLX5, (internal region) Antibodies Ray Biotech 100 μg 353 126-10130 Goat Anti-Human DLX5, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10132 Goat Anti-Human DHX9 RHA, (internal region) Antibodies Ray Biotech 100 μg 353 126-10132 Goat Anti-Human DHX9 RHA, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10133 Goat Anti-Human, Mouse, Rat Desmin, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10133 Goat Anti-Human, Mouse, Rat Desmin, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10134 Goat Anti-Human DAPP1, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10134 Goat Anti-Human DAPP1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10135 Goat Anti-Human Dachshund homolog 1, (internal region) Antibodies Ray Biotech 100 μg 353 126-10135 Goat Anti-Human Dachshund homolog 1, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10137 Goat Anti-Human CTLA + CTLB, (internal region) Antibodies Ray Biotech 100 μg 353 126-10137 Goat Anti-Human CTLA + CTLB, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10138 Goat Anti-Human, Mouse, Rat CSX1 NKX2-5, (internal region) Antibodies Ray Biotech 100 μg 353 126-10138 Goat Anti-Human, Mouse, Rat CSX1 NKX2-5, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10139 Goat Anti-Human CST3 cystatin C, (internal region) Antibodies Ray Biotech 100 μg 353 126-10139 Goat Anti-Human CST3 cystatin C, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10140 Goat Anti-Human, Mouse, Rat CSRP3 , (internal region) Antibodies Ray Biotech 100 μg 353 126-10140 Goat Anti-Human, Mouse, Rat CSRP3 , (internal region) Antibodies Ray Biotech 100 μg 353€
126-10143 Goat Anti-Human COL4A3BP (aa396-411), (internal region) Antibodies Ray Biotech 100 μg 353 126-10143 Goat Anti-Human COL4A3BP (aa396-411), (internal region) Antibodies Ray Biotech 100 μg 353€
126-10144 Goat Anti-Human COG7, (internal region) Antibodies Ray Biotech 100 μg 353 126-10144 Goat Anti-Human COG7, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10145 Goat Anti-Human COG1, (internal region) Antibodies Ray Biotech 100 μg 353 126-10145 Goat Anti-Human COG1, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10147 Goat Anti-Human CLCA1 (aa872-884), (internal region) Antibodies Ray Biotech 100 μg 353 126-10147 Goat Anti-Human CLCA1 (aa872-884), (internal region) Antibodies Ray Biotech 100 μg 353€
126-10148 Goat Anti-Human CHRNB2, (internal region) Antibodies Ray Biotech 100 μg 353 126-10148 Goat Anti-Human CHRNB2, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10149 Goat Anti-Human, Rat CHRNA4 (aa29-43), (internal region) Antibodies Ray Biotech 100 μg 353 126-10149 Goat Anti-Human, Rat CHRNA4 (aa29-43), (internal region) Antibodies Ray Biotech 100 μg 353€
126-10151 Goat Anti-Human CENTG1 PIKE, (internal region) Antibodies Ray Biotech 100 μg 353 126-10151 Goat Anti-Human CENTG1 PIKE, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10152 Goat Anti-Human CDK10 PISSLRE, (N Terminus) Antibodies Ray Biotech 100 μg 353 126-10152 Goat Anti-Human CDK10 PISSLRE, (N Terminus) Antibodies Ray Biotech 100 μg 353€
126-10153 Goat Anti-Human CD20 MS4A1 (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10153 Goat Anti-Human CD20 MS4A1 (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10156 Goat Anti-Human, Mouse, Rat CAV3 , (N Terminus) Antibodies Ray Biotech 100 μg 353 126-10156 Goat Anti-Human, Mouse, Rat CAV3 , (N Terminus) Antibodies Ray Biotech 100 μg 353€
126-10158 Goat Anti-Human CAMK1D, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10158 Goat Anti-Human CAMK1D, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10159 Goat Anti-Human C1D, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10159 Goat Anti-Human C1D, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10161 Goat Anti-Human BMAL1 ARNTL, (internal region) Antibodies Ray Biotech 100 μg 353 126-10161 Goat Anti-Human BMAL1 ARNTL, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10162 Goat Anti-Human Bin3, (internal region) Antibodies Ray Biotech 100 μg 353 126-10162 Goat Anti-Human Bin3, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10165 Goat Anti-Human ARPC4, (internal region) Antibodies Ray Biotech 100 μg 353 126-10165 Goat Anti-Human ARPC4, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10166 Goat Anti-Human ARL4D, (internal region) Antibodies Ray Biotech 100 μg 353 126-10166 Goat Anti-Human ARL4D, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10167 Goat Anti-Human, Mouse AREB6 ZEB1, (internal region) Antibodies Ray Biotech 100 μg 353 126-10167 Goat Anti-Human, Mouse AREB6 ZEB1, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10168 Goat Anti-Human Apolipoprotein M (mouse), (internal region) Antibodies Ray Biotech 100 μg 353 126-10168 Goat Anti-Human Apolipoprotein M (mouse), (internal region) Antibodies Ray Biotech 100 μg 353€
126-10170 Goat Anti-Human APOL5, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10170 Goat Anti-Human APOL5, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10171 Goat Anti-Human APOL3, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10171 Goat Anti-Human APOL3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10172 Goat Anti-Human APOL2, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10172 Goat Anti-Human APOL2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10173 Goat Anti-Human APOL1, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10173 Goat Anti-Human APOL1, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
126-10174 Goat Anti-Human APOBEC3G, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10174 Goat Anti-Human APOBEC3G, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10175 Goat Anti-Human APOBEC3C (C-term), (C terminus) Antibodies Ray Biotech 100 μg 353 126-10175 Goat Anti-Human APOBEC3C (C-term), (C terminus) Antibodies Ray Biotech 100 μg 353€
126-10177 Goat Anti-Human APOA5, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10177 Goat Anti-Human APOA5, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10178 Goat Anti-Human, Mouse, Rat Annexin I, (C Terminus) Antibodies Ray Biotech 100 μg 353 126-10178 Goat Anti-Human, Mouse, Rat Annexin I, (C Terminus) Antibodies Ray Biotech 100 μg 353€
126-10180 Goat Anti-Human ANKK1, (internal region) Antibodies Ray Biotech 100 μg 353 126-10180 Goat Anti-Human ANKK1, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10182 Goat Anti-Human ALOX15, (internal region) Antibodies Ray Biotech 100 μg 353 126-10182 Goat Anti-Human ALOX15, (internal region) Antibodies Ray Biotech 100 μg 353€
126-10185 Goat Anti-Human AADAT, (internal region) Antibodies Ray Biotech 100 μg 353 126-10185 Goat Anti-Human AADAT, (internal region) Antibodies Ray Biotech 100 μg 353€
129-10010 Goat Anti-Human ABCB5 Ray Biotech 100 717 129-10010 Goat Anti-Human ABCB5 Ray Biotech 100 717€ Pub
129-10015 Goat Anti-Human ADIPOR1 (N-term.) Antibodies Ray Biotech 0.1 mg 452 129-10015 Goat Anti-Human ADIPOR1 (N-term.) Antibodies Ray Biotech 0.1 mg 452€
129-10030 Goat Anti-Human Apolipoprotein (A) Ray Biotech 1 mL 264 129-10030 Goat Anti-Human Apolipoprotein (A) Ray Biotech 1 mL 264€
129-10037 Goat Anti-Human Arylsulfatase A Ray Biotech 100 717 129-10037 Goat Anti-Human Arylsulfatase A Ray Biotech 100 717€
129-10041 Goat Anti-Human ASS1 Antibodies Ray Biotech 0.1 mg 502 129-10041 Goat Anti-Human ASS1 Antibodies Ray Biotech 0.1 mg 502€
129-10042 Goat Anti-Human ATF1 Antibodies Ray Biotech 0.1 mg 510 129-10042 Goat Anti-Human ATF1 Antibodies Ray Biotech 0.1 mg 510€
129-10044 Goat Anti-Human ATGL Desnutrin Ray Biotech 100 717 129-10044 Goat Anti-Human ATGL Desnutrin Ray Biotech 100 717€
129-10052 Goat Anti-Human ADRB3 Antibodies Ray Biotech 0.1 mg 502 129-10052 Goat Anti-Human ADRB3 Antibodies Ray Biotech 0.1 mg 502€
129-10054 Goat Anti-Human BHMT (C-term.) Antibodies Ray Biotech 0.1 mg 502 129-10054 Goat Anti-Human BHMT (C-term.) Antibodies Ray Biotech 0.1 mg 502€
129-10064 Goat Anti-Human C3 Antibodies Ray Biotech 1 ml 188 129-10064 Goat Anti-Human C3 Antibodies Ray Biotech 1 ml 188€
129-10081 Goat Anti-Human CCL3L1 Ray Biotech 100 755 129-10081 Goat Anti-Human CCL3L1 Ray Biotech 100 755€
129-10083 Goat Anti-Human CCR10 Ray Biotech 100 604 129-10083 Goat Anti-Human CCR10 Ray Biotech 100 604€
129-10097 Goat Anti-Human CD137 Ray Biotech 100 755 129-10097 Goat Anti-Human CD137 Ray Biotech 100 755€
129-10110 Goat Anti-Human CD192, N-terminus Ray Biotech 100 604 129-10110 Goat Anti-Human CD192, N-terminus Ray Biotech 100 604€
129-10111 Goat Anti-Human CD194 Ray Biotech 100 604 129-10111 Goat Anti-Human CD194 Ray Biotech 100 604€
129-10113 Goat Anti-Human CD195, N-terminus Ray Biotech 100 604 129-10113 Goat Anti-Human CD195, N-terminus Ray Biotech 100 604€
129-10115 Goat Anti-Human CD196 Ray Biotech 100 604 129-10115 Goat Anti-Human CD196 Ray Biotech 100 604€
129-10129 Goat Anti-Human CD262 Ray Biotech 100 604 129-10129 Goat Anti-Human CD262 Ray Biotech 100 604€
129-10142 Goat Anti-Human CD284, N-terminus Ray Biotech 100 604 129-10142 Goat Anti-Human CD284, N-terminus Ray Biotech 100 604€
129-10151 Goat Anti-Human CD344 Ray Biotech 100 717 129-10151 Goat Anti-Human CD344 Ray Biotech 100 717€
129-10183 Goat Anti-Human CDw198, N-terminus Ray Biotech 100 604 129-10183 Goat Anti-Human CDw198, N-terminus Ray Biotech 100 604€
129-10193 Goat Anti-Human CES1 Ray Biotech 100 717 129-10193 Goat Anti-Human CES1 Ray Biotech 100 717€
129-10218 Goat Anti-Human Creatine Phosphokinase Ray Biotech 500 516 129-10218 Goat Anti-Human Creatine Phosphokinase Ray Biotech 500 516€
129-10241 Goat Anti-Human DEFA1 Antibodies Ray Biotech 0.1 mg 510 129-10241 Goat Anti-Human DEFA1 Antibodies Ray Biotech 0.1 mg 510€
129-10252 Goat Anti-Human DNA Methyltransferase 1 Ray Biotech 100 717 129-10252 Goat Anti-Human DNA Methyltransferase 1 Ray Biotech 100 717€
129-10265 Goat Anti-Human DRAK 1 Ray Biotech 100 742 129-10265 Goat Anti-Human DRAK 1 Ray Biotech 100 742€
129-10334 Goat Anti-Human Haptoglobin Ray Biotech 1 mL 264 129-10334 Goat Anti-Human Haptoglobin Ray Biotech 1 mL 264€
129-10352 Goat Anti-Human IgA alpha [+HRP] Antibodies Ray Biotech 2 ml 361 129-10352 Goat Anti-Human IgA alpha [+HRP] Antibodies Ray Biotech 2 ml 361€ Pub
129-10356 Goat Anti-Human IgD Ray Biotech 1 mg 422 129-10356 Goat Anti-Human IgD Ray Biotech 1 mg 422€ Pub
129-10361 Goat Anti-Human IGF2BP2 (C-term.) Antibodies Ray Biotech 0.1 mg 502 129-10361 Goat Anti-Human IGF2BP2 (C-term.) Antibodies Ray Biotech 0.1 mg 502€
129-10387 Goat Anti-Human KAISO Ray Biotech 100 742 129-10387 Goat Anti-Human KAISO Ray Biotech 100 742€
129-10391 Goat Anti-Human KCNJ11 Ray Biotech 100 717 129-10391 Goat Anti-Human KCNJ11 Ray Biotech 100 717€
129-10402 Goat Anti-Human L-Aparaginase Ray Biotech 100 717 129-10402 Goat Anti-Human L-Aparaginase Ray Biotech 100 717€
129-10410 Goat Anti-Human Lipoprotein a Ray Biotech 500 528 129-10410 Goat Anti-Human Lipoprotein a Ray Biotech 500 528€
129-10436 Goat Anti-Human MARK2 Ray Biotech 100 717 129-10436 Goat Anti-Human MARK2 Ray Biotech 100 717€
129-10461 Goat Anti-Human MPP2 Ray Biotech 100 742 129-10461 Goat Anti-Human MPP2 Ray Biotech 100 742€
129-10467 Goat Anti-Human Myoglobin Ray Biotech 1 mL 264 129-10467 Goat Anti-Human Myoglobin Ray Biotech 1 mL 264€
129-10473 Goat Anti-Human NALP3, C-terminus Ray Biotech 50 843 129-10473 Goat Anti-Human NALP3, C-terminus Ray Biotech 50 843€
129-10482 Goat Anti-Human Neurexin 1, C-terminus Ray Biotech 100 717 129-10482 Goat Anti-Human Neurexin 1, C-terminus Ray Biotech 100 717€ Pub
129-10515 Goat Anti-Human pan-Alcohol Dehydrogenase, N-terminus Ray Biotech 100 717 129-10515 Goat Anti-Human pan-Alcohol Dehydrogenase, N-terminus Ray Biotech 100 717€
129-10545 Goat Anti-Human Prealbumin Ray Biotech 1 mL 264 129-10545 Goat Anti-Human Prealbumin Ray Biotech 1 mL 264€
129-10578 Goat Anti-Human RAB8A, C-terminus Ray Biotech 100 717 129-10578 Goat Anti-Human RAB8A, C-terminus Ray Biotech 100 717€
129-10597 Goat Anti-Human RPGRIP1L Ray Biotech 100 717 129-10597 Goat Anti-Human RPGRIP1L Ray Biotech 100 717€
129-10631 Goat Anti-Human hTERT Antibodies Ray Biotech 0.1 mg 510 129-10631 Goat Anti-Human hTERT Antibodies Ray Biotech 0.1 mg 510€
bs-0367G Goat Anti-human C3 Polyclonal Antibody, Unconjugated Bioss 100ug 330 bs-0367G Goat Anti-human C3 Polyclonal Antibody, Unconjugated Bioss 100ug 330€ Pub
DS-PB-00020 Goat Anti-Human 3PAP Antibodies Ray Biotech 0.1 mg 353 DS-PB-00020 Goat Anti-Human 3PAP Antibodies Ray Biotech 0.1 mg 353€
DS-PB-00101 Goat Anti-Human ALDH1A1 Antibodies Ray Biotech 0.1 mg 510 DS-PB-00101 Goat Anti-Human ALDH1A1 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00115 Goat Anti-Human Synuclein alpha Antibodies Ray Biotech 0.1 ml 411 DS-PB-00115 Goat Anti-Human Synuclein alpha Antibodies Ray Biotech 0.1 ml 411€
DS-PB-00155 Goat Anti-Human APP Antibodies Ray Biotech 0.1 ml 411 DS-PB-00155 Goat Anti-Human APP Antibodies Ray Biotech 0.1 ml 411€
DS-PB-00156 Goat Anti-Human APP Antibodies Ray Biotech 1 ml 361 DS-PB-00156 Goat Anti-Human APP Antibodies Ray Biotech 1 ml 361€
DS-PB-00164 Goat Anti-Human APP Antibodies Ray Biotech 0.1 ml 411 DS-PB-00164 Goat Anti-Human APP Antibodies Ray Biotech 0.1 ml 411€
DS-PB-00168 Goat Anti-Human Androgen Receptor (N-term) Antibodies Ray Biotech 0.1 mg 502 DS-PB-00168 Goat Anti-Human Androgen Receptor (N-term) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-00175 Goat Anti-Human ANXA2 Antibodies Ray Biotech 0.1 mg 510 DS-PB-00175 Goat Anti-Human ANXA2 Antibodies Ray Biotech 0.1 mg 510€ Pub
DS-PB-00183 Goat Anti-Human APOE Antibodies Ray Biotech 1 ml 411 DS-PB-00183 Goat Anti-Human APOE Antibodies Ray Biotech 1 ml 411€
DS-PB-00185 Goat Anti-Human SH2B2 Antibodies Ray Biotech 0.1 mg 510 DS-PB-00185 Goat Anti-Human SH2B2 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00188 Goat Anti-Human ARFGAP3 Antibodies Ray Biotech 0.1 mg 568 DS-PB-00188 Goat Anti-Human ARFGAP3 Antibodies Ray Biotech 0.1 mg 568€
DS-PB-00192 Goat Anti-Human ARMET Antibodies Ray Biotech 0.1 mg 510 DS-PB-00192 Goat Anti-Human ARMET Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00203 Goat Anti-Human ATF4 Antibodies Ray Biotech 0.1 mg 411 DS-PB-00203 Goat Anti-Human ATF4 Antibodies Ray Biotech 0.1 mg 411€
DS-PB-00206 Goat Anti-Human ATF7 Antibodies Ray Biotech 0.1 mg 510 DS-PB-00206 Goat Anti-Human ATF7 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00218 Goat Anti-Human BACE1 (C-term) Antibodies Ray Biotech 0.1 ml 411 DS-PB-00218 Goat Anti-Human BACE1 (C-term) Antibodies Ray Biotech 0.1 ml 411€
DS-PB-00225 Goat Anti-Human BAIAP2 Antibodies Ray Biotech 0.1 mg 510 DS-PB-00225 Goat Anti-Human BAIAP2 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00242 Goat Anti-Human BCL7A Antibodies Ray Biotech 0.1 mg 510 DS-PB-00242 Goat Anti-Human BCL7A Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00272 Goat Anti-Human BKS (C-term) Antibodies Ray Biotech 0.1 mg 518 DS-PB-00272 Goat Anti-Human BKS (C-term) Antibodies Ray Biotech 0.1 mg 518€
DS-PB-00300 Goat Anti-Human BPOZ Antibodies Ray Biotech 0.1 mg 510 DS-PB-00300 Goat Anti-Human BPOZ Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00304 Goat Anti-Human BRDG1 Antibodies Ray Biotech 0.1 mg 510 DS-PB-00304 Goat Anti-Human BRDG1 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00355 Goat Anti-Human CAPZB Antibodies Ray Biotech 0.1 mg 733 DS-PB-00355 Goat Anti-Human CAPZB Antibodies Ray Biotech 0.1 mg 733€
DS-PB-00370 Goat Anti-Human Casein Kinase 1 delta (C-term) Antibodies Ray Biotech 0.1 ml 411 DS-PB-00370 Goat Anti-Human Casein Kinase 1 delta (C-term) Antibodies Ray Biotech 0.1 ml 411€ Pub
DS-PB-00399 Goat Anti-Human CD154 Antibodies Ray Biotech 0.1 mg 510 DS-PB-00399 Goat Anti-Human CD154 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00400 Goat Anti-Human CD154 [+Biotin] Antibodies Ray Biotech 50 510 DS-PB-00400 Goat Anti-Human CD154 [+Biotin] Antibodies Ray Biotech 50 510€
DS-PB-00402 Goat Anti-Human CD156b (C-term) Antibodies Ray Biotech 0.1 mg 502 DS-PB-00402 Goat Anti-Human CD156b (C-term) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-00417 Goat Anti-Human CD230 Antibodies Ray Biotech 0.1 ml 452 DS-PB-00417 Goat Anti-Human CD230 Antibodies Ray Biotech 0.1 ml 452€ Pub
DS-PB-00418 Goat Anti-Human CD230 Antibodies Ray Biotech 10 188 DS-PB-00418 Goat Anti-Human CD230 Antibodies Ray Biotech 10 188€ Pub
DS-PB-00441 Goat Anti-Human CD314 Antibodies Ray Biotech 0.1 mg 502 DS-PB-00441 Goat Anti-Human CD314 Antibodies Ray Biotech 0.1 mg 502€
DS-PB-00460 Goat Anti-Human Chk1 Antibodies Ray Biotech 50 411 DS-PB-00460 Goat Anti-Human Chk1 Antibodies Ray Biotech 50 411€
DS-PB-00473 Goat Anti-Human Choline Acetyltransferase Antibodies Ray Biotech 50 832 DS-PB-00473 Goat Anti-Human Choline Acetyltransferase Antibodies Ray Biotech 50 832€
DS-PB-00502 Goat Anti-Human Cofilin 2 (C-term) Antibodies Ray Biotech 0.1 mg 502 DS-PB-00502 Goat Anti-Human Cofilin 2 (C-term) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-00504 Goat Anti-Human Collagen I Antibodies Ray Biotech 0.2 mg 535 DS-PB-00504 Goat Anti-Human Collagen I Antibodies Ray Biotech 0.2 mg 535€
DS-PB-00505 Goat Anti-Human Collagen I [+Biotin] Antibodies Ray Biotech 0.2 mg 766 DS-PB-00505 Goat Anti-Human Collagen I [+Biotin] Antibodies Ray Biotech 0.2 mg 766€ Pub
DS-PB-00517 Goat Anti-Human Collagen III Antibodies Ray Biotech 0.2 mg 535 DS-PB-00517 Goat Anti-Human Collagen III Antibodies Ray Biotech 0.2 mg 535€ Pub
DS-PB-00522 Goat Anti-Human Collagen IV Antibodies Ray Biotech 0.2 mg 733 DS-PB-00522 Goat Anti-Human Collagen IV Antibodies Ray Biotech 0.2 mg 733€
DS-PB-00525 Goat Anti-Human Collagen V Antibodies Ray Biotech 0.2 mg 766 DS-PB-00525 Goat Anti-Human Collagen V Antibodies Ray Biotech 0.2 mg 766€
DS-PB-00527 Goat Anti-Human Collagen VI Antibodies Ray Biotech 0.2 mg 766 DS-PB-00527 Goat Anti-Human Collagen VI Antibodies Ray Biotech 0.2 mg 766€ Pub
DS-PB-00532 Goat Anti-Human Cortactin Antibodies Ray Biotech 0.1 mg 510 DS-PB-00532 Goat Anti-Human Cortactin Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00556 Goat Anti-Human CSK Antibodies Ray Biotech 0.1 mg 518 DS-PB-00556 Goat Anti-Human CSK Antibodies Ray Biotech 0.1 mg 518€
DS-PB-00608 Goat Anti-Human DDAH1 Antibodies Ray Biotech 0.1 mg 510 DS-PB-00608 Goat Anti-Human DDAH1 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00609 Goat Anti-Human DDAH2 Antibodies Ray Biotech 0.1 mg 510 DS-PB-00609 Goat Anti-Human DDAH2 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00610 Goat Anti-Human DEFB2 Antibodies Ray Biotech 0.1 mg 502 DS-PB-00610 Goat Anti-Human DEFB2 Antibodies Ray Biotech 0.1 mg 502€
DS-PB-00611 Goat Anti-Human DEFB2 [+Biotin] Antibodies Ray Biotech 50 510 DS-PB-00611 Goat Anti-Human DEFB2 [+Biotin] Antibodies Ray Biotech 50 510€
DS-PB-00652 Goat Anti-Human DOCK1 Antibodies Ray Biotech 0.1 mg 510 DS-PB-00652 Goat Anti-Human DOCK1 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00670 Goat Anti-Human DRAK2 Antibodies Ray Biotech 0.1 mg 518 DS-PB-00670 Goat Anti-Human DRAK2 Antibodies Ray Biotech 0.1 mg 518€
DS-PB-00674 Goat Anti-Human DUSP1 Antibodies Ray Biotech 0.1 mg 510 DS-PB-00674 Goat Anti-Human DUSP1 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00675 Goat Anti-Human DUSP10 Antibodies Ray Biotech 0.1 mg 510 DS-PB-00675 Goat Anti-Human DUSP10 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00684 Goat Anti-Human Dysadherin Antibodies Ray Biotech 0.1 mg 510 DS-PB-00684 Goat Anti-Human Dysadherin Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00695 Goat Anti-Human EGR2 Antibodies Ray Biotech 0.1 mg 510 DS-PB-00695 Goat Anti-Human EGR2 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00698 Goat Anti-Human ELMO1 Antibodies Ray Biotech 0.1 mg 510 DS-PB-00698 Goat Anti-Human ELMO1 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00699 Goat Anti-Human ELMO2 Antibodies Ray Biotech 0.1 mg 510 DS-PB-00699 Goat Anti-Human ELMO2 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00700 Goat Anti-Human ELMO3 Antibodies Ray Biotech 0.1 mg 510 DS-PB-00700 Goat Anti-Human ELMO3 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00709 Goat Anti-Human Eotaxin-2 CCL24 Antibodies Ray Biotech 0.1 mg 452 DS-PB-00709 Goat Anti-Human Eotaxin-2 CCL24 Antibodies Ray Biotech 0.1 mg 452€
DS-PB-00754 Goat Anti-Human FEM1A (C-term) Antibodies Ray Biotech 0.1 mg 452 DS-PB-00754 Goat Anti-Human FEM1A (C-term) Antibodies Ray Biotech 0.1 mg 452€
DS-PB-00755 Goat Anti-Human FEM1B Antibodies Ray Biotech 0.1 mg 510 DS-PB-00755 Goat Anti-Human FEM1B Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00757 Goat Anti-Human FER Antibodies Ray Biotech 0.1 mg 510 DS-PB-00757 Goat Anti-Human FER Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00761 Goat Anti-Human Ferritin Antibodies Ray Biotech 1 ml 535 DS-PB-00761 Goat Anti-Human Ferritin Antibodies Ray Biotech 1 ml 535€
DS-PB-00763 Goat Anti-Human Ferritin Antibodies Ray Biotech 1 mg 568 DS-PB-00763 Goat Anti-Human Ferritin Antibodies Ray Biotech 1 mg 568€
DS-PB-00795 Goat Anti-Human FRK Antibodies Ray Biotech 0.1 mg 510 DS-PB-00795 Goat Anti-Human FRK Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00805 Goat Anti-Human FYN Antibodies Ray Biotech 0.1 mg 518 DS-PB-00805 Goat Anti-Human FYN Antibodies Ray Biotech 0.1 mg 518€
DS-PB-00837 Goat Anti-Human GADD34 Antibodies Ray Biotech 0.1 mg 518 DS-PB-00837 Goat Anti-Human GADD34 Antibodies Ray Biotech 0.1 mg 518€
DS-PB-00846 Goat Anti-Human GAPDH (C-term) Antibodies Ray Biotech 0.1 mg 502 DS-PB-00846 Goat Anti-Human GAPDH (C-term) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-00921 Goat Anti-Human GRAP Antibodies Ray Biotech 0.1 mg 510 DS-PB-00921 Goat Anti-Human GRAP Antibodies Ray Biotech 0.1 mg 510€
DS-PB-00922 Goat Anti-Human Gravin Antibodies Ray Biotech 0.1 mg 510 DS-PB-00922 Goat Anti-Human Gravin Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01034 Goat Anti-Human ICEBERG Antibodies Ray Biotech 0.1 mg 510 DS-PB-01034 Goat Anti-Human ICEBERG Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01048 Goat Anti-Human IFN-gamma Receptor 1 Antibodies Ray Biotech 50 601 DS-PB-01048 Goat Anti-Human IFN-gamma Receptor 1 Antibodies Ray Biotech 50 601€
DS-PB-01085 Goat Anti-Human IL-12 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01085 Goat Anti-Human IL-12 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01086 Goat Anti-Human IL-12 [+Biotin] Antibodies Ray Biotech 50 510 DS-PB-01086 Goat Anti-Human IL-12 [+Biotin] Antibodies Ray Biotech 50 510€
DS-PB-01184 Goat Anti-Human JAW 1 Antibodies Ray Biotech 0.1 mg 733 DS-PB-01184 Goat Anti-Human JAW 1 Antibodies Ray Biotech 0.1 mg 733€
DS-PB-01192 Goat Anti-Human KIAA0191 Protein Antibodies Ray Biotech 0.1 mg 510 DS-PB-01192 Goat Anti-Human KIAA0191 Protein Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01217 Goat Anti-Human LASP-1 Antibodies Ray Biotech 0.1 mg 733 DS-PB-01217 Goat Anti-Human LASP-1 Antibodies Ray Biotech 0.1 mg 733€
DS-PB-01246 Goat Anti-Human Livin Antibodies Ray Biotech 0.1 mg 518 DS-PB-01246 Goat Anti-Human Livin Antibodies Ray Biotech 0.1 mg 518€
DS-PB-01250 Goat Anti-Human LNK (N-term) Antibodies Ray Biotech 0.1 mg 502 DS-PB-01250 Goat Anti-Human LNK (N-term) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-01262 Goat Anti-Human LXR alpha beta Antibodies Ray Biotech 0.1 mg 510 DS-PB-01262 Goat Anti-Human LXR alpha beta Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01283 Goat Anti-Human MCM3 Antibodies Ray Biotech 0.1 mg 584 DS-PB-01283 Goat Anti-Human MCM3 Antibodies Ray Biotech 0.1 mg 584€
DS-PB-01284 Goat Anti-Human MCM4 Antibodies Ray Biotech 0.1 mg 568 DS-PB-01284 Goat Anti-Human MCM4 Antibodies Ray Biotech 0.1 mg 568€
DS-PB-01303 Goat Anti-Human MCT2 Antibodies Ray Biotech 0.1 mg 452 DS-PB-01303 Goat Anti-Human MCT2 Antibodies Ray Biotech 0.1 mg 452€
DS-PB-01334 Goat Anti-Human MIP-1 alpha CCL3 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01334 Goat Anti-Human MIP-1 alpha CCL3 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01348 Goat Anti-Human MKP-7 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01348 Goat Anti-Human MKP-7 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01360 Goat Anti-Human MMP7 Antibodies Ray Biotech 0.1 mg 502 DS-PB-01360 Goat Anti-Human MMP7 Antibodies Ray Biotech 0.1 mg 502€
DS-PB-01374 Goat Anti-Human MSC Antibodies Ray Biotech 0.1 mg 510 DS-PB-01374 Goat Anti-Human MSC Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01377 Goat Anti-Human MSR Type I Antibodies Ray Biotech 0.1 ml 411 DS-PB-01377 Goat Anti-Human MSR Type I Antibodies Ray Biotech 0.1 ml 411€
DS-PB-01378 Goat Anti-Human MSR Type I Antibodies Ray Biotech 20 196 DS-PB-01378 Goat Anti-Human MSR Type I Antibodies Ray Biotech 20 196€
DS-PB-01379 Goat Anti-Human MST4 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01379 Goat Anti-Human MST4 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01380 Goat Anti-Human MTA1 Antibodies Ray Biotech 0.1 mg 518 DS-PB-01380 Goat Anti-Human MTA1 Antibodies Ray Biotech 0.1 mg 518€
DS-PB-01381 Goat Anti-Human MTA1L1 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01381 Goat Anti-Human MTA1L1 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01383 Goat Anti-Human MTM1 Antibodies Ray Biotech 0.1 mg 535 DS-PB-01383 Goat Anti-Human MTM1 Antibodies Ray Biotech 0.1 mg 535€
DS-PB-01385 Goat Anti-Human MTR Antibodies Ray Biotech 0.1 mg 733 DS-PB-01385 Goat Anti-Human MTR Antibodies Ray Biotech 0.1 mg 733€
DS-PB-01387 Goat Anti-Human MXI1 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01387 Goat Anti-Human MXI1 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01403 Goat Anti-Human Napsin A Antibodies Ray Biotech 0.1 mg 733 DS-PB-01403 Goat Anti-Human Napsin A Antibodies Ray Biotech 0.1 mg 733€
DS-PB-01404 Goat Anti-Human NBR2 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01404 Goat Anti-Human NBR2 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01446 Goat Anti-Human NFIL3 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01446 Goat Anti-Human NFIL3 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01464 Goat Anti-Human nNOS Antibodies Ray Biotech 0.1 mg 510 DS-PB-01464 Goat Anti-Human nNOS Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01492 Goat Anti-Human NSP3 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01492 Goat Anti-Human NSP3 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01507 Goat Anti-Human ORC3L Antibodies Ray Biotech 0.1 mg 518 DS-PB-01507 Goat Anti-Human ORC3L Antibodies Ray Biotech 0.1 mg 518€
DS-PB-01508 Goat Anti-Human ORC4L (C-term) Antibodies Ray Biotech 0.1 mg 485 DS-PB-01508 Goat Anti-Human ORC4L (C-term) Antibodies Ray Biotech 0.1 mg 485€
DS-PB-01509 Goat Anti-Human ORC6L Antibodies Ray Biotech 0.1 mg 510 DS-PB-01509 Goat Anti-Human ORC6L Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01526 Goat Anti-Human Osteopontin (C-term) Antibodies Ray Biotech 0.1 mg 502 DS-PB-01526 Goat Anti-Human Osteopontin (C-term) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-01540 Goat Anti-Human PAMCI Antibodies Ray Biotech 0.1 mg 510 DS-PB-01540 Goat Anti-Human PAMCI Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01562 Goat Anti-Human Parkin Antibodies Ray Biotech 0.1 ml 411 DS-PB-01562 Goat Anti-Human Parkin Antibodies Ray Biotech 0.1 ml 411€
DS-PB-01571 Goat Anti-Human PDIA3 (C-term) Antibodies Ray Biotech 0.1 mg 510 DS-PB-01571 Goat Anti-Human PDIA3 (C-term) Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01578 Goat Anti-Human Pericentrin 1 (C-term) Antibodies Ray Biotech 0.1 mg 510 DS-PB-01578 Goat Anti-Human Pericentrin 1 (C-term) Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01586 Goat Anti-Human PGAM1 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01586 Goat Anti-Human PGAM1 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01617 Goat Anti-Human PIRIN Antibodies Ray Biotech 0.1 mg 510 DS-PB-01617 Goat Anti-Human PIRIN Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01633 Goat Anti-Human PLRG1 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01633 Goat Anti-Human PLRG1 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01639 Goat Anti-Human PPP2CA Antibodies Ray Biotech 0.1 mg 733 DS-PB-01639 Goat Anti-Human PPP2CA Antibodies Ray Biotech 0.1 mg 733€
DS-PB-01640 Goat Anti-Human PPP2R5A Antibodies Ray Biotech 0.1 mg 510 DS-PB-01640 Goat Anti-Human PPP2R5A Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01641 Goat Anti-Human PPP2R5B Antibodies Ray Biotech 0.1 mg 510 DS-PB-01641 Goat Anti-Human PPP2R5B Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01643 Goat Anti-Human PPP2R5D Antibodies Ray Biotech 0.1 mg 510 DS-PB-01643 Goat Anti-Human PPP2R5D Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01644 Goat Anti-Human PPP2R5E Antibodies Ray Biotech 0.1 mg 510 DS-PB-01644 Goat Anti-Human PPP2R5E Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01645 Goat Anti-Human PRAM1 Antibodies Ray Biotech 0.1 mg 518 DS-PB-01645 Goat Anti-Human PRAM1 Antibodies Ray Biotech 0.1 mg 518€
DS-PB-01651 Goat Anti-Human Presenilin-1 Antibodies Ray Biotech 0.1 ml 411 DS-PB-01651 Goat Anti-Human Presenilin-1 Antibodies Ray Biotech 0.1 ml 411€
DS-PB-01654 Goat Anti-Human Presenilin-2 Antibodies Ray Biotech 0.1 ml 411 DS-PB-01654 Goat Anti-Human Presenilin-2 Antibodies Ray Biotech 0.1 ml 411€
DS-PB-01655 Goat Anti-Human Presenilin-2 Antibodies Ray Biotech 20 205 DS-PB-01655 Goat Anti-Human Presenilin-2 Antibodies Ray Biotech 20 205€
DS-PB-01678 Goat Anti-Human PGP 9.5 (N-term) Antibodies Ray Biotech 0.1 ml 411 DS-PB-01678 Goat Anti-Human PGP 9.5 (N-term) Antibodies Ray Biotech 0.1 ml 411€
DS-PB-01706 Goat Anti-Human RAB2 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01706 Goat Anti-Human RAB2 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01707 Goat Anti-Human RAC2 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01707 Goat Anti-Human RAC2 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01708 Goat Anti-Human RACGAP1 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01708 Goat Anti-Human RACGAP1 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01710 Goat Anti-Human RAD17 Antibodies Ray Biotech 0.1 mg 568 DS-PB-01710 Goat Anti-Human RAD17 Antibodies Ray Biotech 0.1 mg 568€
DS-PB-01713 Goat Anti-Human RAGE Antibodies Ray Biotech 0.1 ml 411 DS-PB-01713 Goat Anti-Human RAGE Antibodies Ray Biotech 0.1 ml 411€
DS-PB-01782 Goat Anti-Human SDF-1 beta. [+Biotin] Antibodies Ray Biotech 50 510 DS-PB-01782 Goat Anti-Human SDF-1 beta. [+Biotin] Antibodies Ray Biotech 50 510€
DS-PB-01783 Goat Anti-Human SEC61A1 Antibodies Ray Biotech 0.1 mg 518 DS-PB-01783 Goat Anti-Human SEC61A1 Antibodies Ray Biotech 0.1 mg 518€
DS-PB-01785 Goat Anti-Human Serine Threonine Kinase 15 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01785 Goat Anti-Human Serine Threonine Kinase 15 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01796 Goat Anti-Human SET Antibodies Ray Biotech 0.1 mg 584 DS-PB-01796 Goat Anti-Human SET Antibodies Ray Biotech 0.1 mg 584€
DS-PB-01801 Goat Anti-Human SH2-B Antibodies Ray Biotech 0.1 mg 510 DS-PB-01801 Goat Anti-Human SH2-B Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01803 Goat Anti-Human SH2D1A Antibodies Ray Biotech 0.1 mg 510 DS-PB-01803 Goat Anti-Human SH2D1A Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01804 Goat Anti-Human SHB Antibodies Ray Biotech 0.1 mg 510 DS-PB-01804 Goat Anti-Human SHB Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01805 Goat Anti-Human SHF Antibodies Ray Biotech 0.1 mg 510 DS-PB-01805 Goat Anti-Human SHF Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01807 Goat Anti-Human SHP2 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01807 Goat Anti-Human SHP2 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01809 Goat Anti-Human SIAH-1 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01809 Goat Anti-Human SIAH-1 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01812 Goat Anti-Human SLI Antibodies Ray Biotech 0.1 mg 510 DS-PB-01812 Goat Anti-Human SLI Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01816 Goat Anti-Human SMAD2 Antibodies Ray Biotech 0.1 mg 518 DS-PB-01816 Goat Anti-Human SMAD2 Antibodies Ray Biotech 0.1 mg 518€
DS-PB-01825 Goat Anti-Human SMURF2 Antibodies Ray Biotech 0.1 mg 535 DS-PB-01825 Goat Anti-Human SMURF2 Antibodies Ray Biotech 0.1 mg 535€
DS-PB-01826 Goat Anti-Human SNAP-25 (C-term) Antibodies Ray Biotech 0.1 mg 510 DS-PB-01826 Goat Anti-Human SNAP-25 (C-term) Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01829 Goat Anti-Human SOCS-2 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01829 Goat Anti-Human SOCS-2 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01830 Goat Anti-Human SOCS-3 Antibodies Ray Biotech 0.1 mg 584 DS-PB-01830 Goat Anti-Human SOCS-3 Antibodies Ray Biotech 0.1 mg 584€
DS-PB-01852 Goat Anti-Human SPHK1 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01852 Goat Anti-Human SPHK1 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01869 Goat Anti-Human STAT1 alpha Antibodies Ray Biotech 0.1 mg 510 DS-PB-01869 Goat Anti-Human STAT1 alpha Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01873 Goat Anti-Human SCF Antibodies Ray Biotech 0.1 mg 510 DS-PB-01873 Goat Anti-Human SCF Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01876 Goat Anti-Human STK18 Antibodies Ray Biotech 0.1 mg 510 DS-PB-01876 Goat Anti-Human STK18 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01904 Goat Anti-Human Synphilin 1 Antibodies Ray Biotech 0.1 ml 411 DS-PB-01904 Goat Anti-Human Synphilin 1 Antibodies Ray Biotech 0.1 ml 411€
DS-PB-01905 Goat Anti-Human Syntrophin alpha-1 Antibodies Ray Biotech 0.1 mg 502 DS-PB-01905 Goat Anti-Human Syntrophin alpha-1 Antibodies Ray Biotech 0.1 mg 502€
DS-PB-01912 Goat Anti-Human Tau (aa 1-16) Antibodies Ray Biotech 0.1 ml 411 DS-PB-01912 Goat Anti-Human Tau (aa 1-16) Antibodies Ray Biotech 0.1 ml 411€
DS-PB-01931 Goat Anti-Human TFPI Antibodies Ray Biotech 0.1 mg 733 DS-PB-01931 Goat Anti-Human TFPI Antibodies Ray Biotech 0.1 mg 733€
DS-PB-01966 Goat Anti-Human TIRAP Antibodies Ray Biotech 0.1 mg 510 DS-PB-01966 Goat Anti-Human TIRAP Antibodies Ray Biotech 0.1 mg 510€
DS-PB-01969 Rabbit Anti-Human TLR5 Antibodies Ray Biotech 0.1 mg 386 DS-PB-01969 Rabbit Anti-Human TLR5 Antibodies Ray Biotech 0.1 mg 386€
DS-PB-01971 Goat Anti-Human TMX (C-term) Antibodies Ray Biotech 0.1 mg 518 DS-PB-01971 Goat Anti-Human TMX (C-term) Antibodies Ray Biotech 0.1 mg 518€
DS-PB-02002 Goat Anti-Human Transferrin Antibodies Ray Biotech 1 mg 257 DS-PB-02002 Goat Anti-Human Transferrin Antibodies Ray Biotech 1 mg 257€
DS-PB-02013 Goat Anti-Human Troponin I Antibodies Ray Biotech 0.2 mg 353 DS-PB-02013 Goat Anti-Human Troponin I Antibodies Ray Biotech 0.2 mg 353€
DS-PB-02015 Goat Anti-Human TRPM7 Antibodies Ray Biotech 0.1 mg 510 DS-PB-02015 Goat Anti-Human TRPM7 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02058 Goat Anti-Human Urokinase (C-term) Antibodies Ray Biotech 0.1 mg 502 DS-PB-02058 Goat Anti-Human Urokinase (C-term) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02109 Goat Anti-Human VEGF VEGF-A [+Biotin] Antibodies Ray Biotech 50 510 DS-PB-02109 Goat Anti-Human VEGF VEGF-A [+Biotin] Antibodies Ray Biotech 50 510€
DS-PB-02202 Goat Anti-Human NUMB (C-term) Antibodies Ray Biotech 0.1 mg 502 DS-PB-02202 Goat Anti-Human NUMB (C-term) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02203 Goat Anti-Human 5-Hydroxymethyluridine Antibodies Ray Biotech 0.1 ml 411 DS-PB-02203 Goat Anti-Human 5-Hydroxymethyluridine Antibodies Ray Biotech 0.1 ml 411€
DS-PB-02204 Goat Anti-Human AGE Antibodies Ray Biotech 0.1 ml 411 DS-PB-02204 Goat Anti-Human AGE Antibodies Ray Biotech 0.1 ml 411€
DS-PB-02205 Goat Anti-Human APP (aa 44-63) Antibodies Ray Biotech 0.1 ml 411 DS-PB-02205 Goat Anti-Human APP (aa 44-63) Antibodies Ray Biotech 0.1 ml 411€
DS-PB-02210 Goat Anti-Human CAV1 Antibodies Ray Biotech 0.1 mg 510 DS-PB-02210 Goat Anti-Human CAV1 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02211 Goat Anti-Human CBX3 Antibodies Ray Biotech 0.1 mg 510 DS-PB-02211 Goat Anti-Human CBX3 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02212 Goat Anti-Human Cholesterol 24-Hydroxylase (C-term) Antibodies Ray Biotech 0.1 ml 411 DS-PB-02212 Goat Anti-Human Cholesterol 24-Hydroxylase (C-term) Antibodies Ray Biotech 0.1 ml 411€
DS-PB-02213 Goat Anti-Human CRKL Antibodies Ray Biotech 0.1 mg 518 DS-PB-02213 Goat Anti-Human CRKL Antibodies Ray Biotech 0.1 mg 518€
DS-PB-02214 Goat Anti-Human CRMP2 (C-term) Antibodies Ray Biotech 0.1 ml 411 DS-PB-02214 Goat Anti-Human CRMP2 (C-term) Antibodies Ray Biotech 0.1 ml 411€
DS-PB-02216 Goat Anti-Human DDB1 (C-term) Antibodies Ray Biotech 0.1 mg 518 DS-PB-02216 Goat Anti-Human DDB1 (C-term) Antibodies Ray Biotech 0.1 mg 518€
DS-PB-02234 Goat Anti-Human ErbB3 HER3 (C-term) Antibodies Ray Biotech 0.1 mg 411 DS-PB-02234 Goat Anti-Human ErbB3 HER3 (C-term) Antibodies Ray Biotech 0.1 mg 411€
DS-PB-02235 Goat Anti-Human FOXO3A Antibodies Ray Biotech 0.1 mg 510 DS-PB-02235 Goat Anti-Human FOXO3A Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02236 Goat Anti-Human HCLS1 Antibodies Ray Biotech 0.1 mg 452 DS-PB-02236 Goat Anti-Human HCLS1 Antibodies Ray Biotech 0.1 mg 452€
DS-PB-02237 Goat Anti-Human ADAM-12 (N-term.) Antibodies Ray Biotech 0.1 mg 502 DS-PB-02237 Goat Anti-Human ADAM-12 (N-term.) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02240 Goat Anti-Human APOB Antibodies Ray Biotech 0.1 mg 411 DS-PB-02240 Goat Anti-Human APOB Antibodies Ray Biotech 0.1 mg 411€
DS-PB-02242 Goat Anti-Human ATF2 Antibodies Ray Biotech 0.1 mg 510 DS-PB-02242 Goat Anti-Human ATF2 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02243 Goat Anti-Human BAK BAK1 Antibodies Ray Biotech 0.1 mg 510 DS-PB-02243 Goat Anti-Human BAK BAK1 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02244 Goat Anti-Human BID (C-term) Antibodies Ray Biotech 0.1 mg 510 DS-PB-02244 Goat Anti-Human BID (C-term) Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02245 Goat Anti-Human BLNK Antibodies Ray Biotech 0.1 mg 386 DS-PB-02245 Goat Anti-Human BLNK Antibodies Ray Biotech 0.1 mg 386€
DS-PB-02246 Goat Anti-Human CASP3 Antibodies Ray Biotech 0.1 mg 510 DS-PB-02246 Goat Anti-Human CASP3 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02247 Goat Anti-Human CBL Antibodies Ray Biotech 0.1 mg 510 DS-PB-02247 Goat Anti-Human CBL Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02248 Goat Anti-Human CD14 Antibodies Ray Biotech 0.1 mg 502 DS-PB-02248 Goat Anti-Human CD14 Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02249 Goat Anti-Human CD230 (aa 143-153) Antibodies Ray Biotech 0.1 mg 502 DS-PB-02249 Goat Anti-Human CD230 (aa 143-153) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02251 Goat Anti-Human CD318 (C-term) Antibodies Ray Biotech 0.1 mg 502 DS-PB-02251 Goat Anti-Human CD318 (C-term) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02252 Goat Anti-Human CD44v3-v10 Antibodies Ray Biotech 1 mg 485 DS-PB-02252 Goat Anti-Human CD44v3-v10 Antibodies Ray Biotech 1 mg 485€
DS-PB-02253 Goat Anti-Human CDKN2A (C-term) Antibodies Ray Biotech 0.1 mg 510 DS-PB-02253 Goat Anti-Human CDKN2A (C-term) Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02254 Goat Anti-Human CDX2 Antibodies Ray Biotech 0.1 mg 502 DS-PB-02254 Goat Anti-Human CDX2 Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02256 Goat Anti-Human Chromogranin A Antibodies Ray Biotech 0.1 mg 502 DS-PB-02256 Goat Anti-Human Chromogranin A Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02257 Goat Anti-Human ERK1 MAPK31 (N-term) Antibodies Ray Biotech 0.1 mg 510 DS-PB-02257 Goat Anti-Human ERK1 MAPK31 (N-term) Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02258 Goat Anti-Human EZRIN Antibodies Ray Biotech 0.1 mg 502 DS-PB-02258 Goat Anti-Human EZRIN Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02260 Goat Anti-Human FTCD (N-term) Antibodies Ray Biotech 0.1 mg 502 DS-PB-02260 Goat Anti-Human FTCD (N-term) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02261 Goat Anti-Human GFAP (C-term) Antibodies Ray Biotech 0.1 mg 502 DS-PB-02261 Goat Anti-Human GFAP (C-term) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02262 Goat Anti-Human Glucagon Antibodies Ray Biotech 0.5 ml 223 DS-PB-02262 Goat Anti-Human Glucagon Antibodies Ray Biotech 0.5 ml 223€
DS-PB-02263 Goat Anti-Human Glucagon (N-term) Antibodies Ray Biotech 1 ml 309 DS-PB-02263 Goat Anti-Human Glucagon (N-term) Antibodies Ray Biotech 1 ml 309€
DS-PB-02264 Goat Anti-Human GPX1 Antibodies Ray Biotech 0.1 mg 502 DS-PB-02264 Goat Anti-Human GPX1 Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02265 Goat Anti-Human GRB2 Antibodies Ray Biotech 0.1 mg 510 DS-PB-02265 Goat Anti-Human GRB2 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02266 Goat Anti-Human HP1 beta Antibodies Ray Biotech 50 411 DS-PB-02266 Goat Anti-Human HP1 beta Antibodies Ray Biotech 50 411€
DS-PB-02268 Goat Anti-Human Hsc70 Antibodies Ray Biotech 0.1 mg 502 DS-PB-02268 Goat Anti-Human Hsc70 Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02269 Goat Anti-Human IgG F(ab')2 (+Alk. Phos.) Antibodies Ray Biotech 0.5 ml 518 DS-PB-02269 Goat Anti-Human IgG F(ab')2 (+Alk. Phos.) Antibodies Ray Biotech 0.5 ml 518€
DS-PB-02270 Goat Anti-Human IgG F(ab')2 [+Biotin] Antibodies Ray Biotech 0.5 mg 353 DS-PB-02270 Goat Anti-Human IgG F(ab')2 [+Biotin] Antibodies Ray Biotech 0.5 mg 353€
DS-PB-02271 Goat Anti-Human IgG F(ab')2 [+FITC] Antibodies Ray Biotech 0.5 mg 353 DS-PB-02271 Goat Anti-Human IgG F(ab')2 [+FITC] Antibodies Ray Biotech 0.5 mg 353€
DS-PB-02272 Goat Anti-Human IgG F(ab')2 [+HRP] Antibodies Ray Biotech 0.5 ml 353 DS-PB-02272 Goat Anti-Human IgG F(ab')2 [+HRP] Antibodies Ray Biotech 0.5 ml 353€
DS-PB-02273 Goat Anti-Human IgG F(ab')2 (+TRITC) Antibodies Ray Biotech 0.5 mg 353 DS-PB-02273 Goat Anti-Human IgG F(ab')2 (+TRITC) Antibodies Ray Biotech 0.5 mg 353€
DS-PB-02274 Goat Anti-Human IgG gamma Antibodies Ray Biotech 0.8 mg 292 DS-PB-02274 Goat Anti-Human IgG gamma Antibodies Ray Biotech 0.8 mg 292€
DS-PB-02275 Goat Anti-Human IgG gamma [+FITC] Antibodies Ray Biotech 0.7 mg 292 DS-PB-02275 Goat Anti-Human IgG gamma [+FITC] Antibodies Ray Biotech 0.7 mg 292€
DS-PB-02276 Goat Anti-Human IgG gamma [+HRP] Antibodies Ray Biotech 0.8 mg 292 DS-PB-02276 Goat Anti-Human IgG gamma [+HRP] Antibodies Ray Biotech 0.8 mg 292€
DS-PB-02277 Goat Anti-Human IgG IgA IgM Antibodies Ray Biotech 2 mg 361 DS-PB-02277 Goat Anti-Human IgG IgA IgM Antibodies Ray Biotech 2 mg 361€
DS-PB-02278 Goat Anti-Human IgG IgA IgM Antibodies Ray Biotech 2 mg 452 DS-PB-02278 Goat Anti-Human IgG IgA IgM Antibodies Ray Biotech 2 mg 452€
DS-PB-02280 Goat Anti-Human IRSp53 (C-term.) Antibodies Ray Biotech 0.1 mg 502 DS-PB-02280 Goat Anti-Human IRSp53 (C-term.) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02281 Goat Anti-Human Kappa Light Chain (+AP) Antibodies Ray Biotech 1 ml 502 DS-PB-02281 Goat Anti-Human Kappa Light Chain (+AP) Antibodies Ray Biotech 1 ml 502€
DS-PB-02282 Goat Anti-Human Kappa Light Chain [+Biotin] Antibodies Ray Biotech 1 mg 502 DS-PB-02282 Goat Anti-Human Kappa Light Chain [+Biotin] Antibodies Ray Biotech 1 mg 502€
DS-PB-02283 Goat Anti-Human Kappa Light Chain [+FITC] Antibodies Ray Biotech 1 mg 353 DS-PB-02283 Goat Anti-Human Kappa Light Chain [+FITC] Antibodies Ray Biotech 1 mg 353€
DS-PB-02285 Goat Anti-Human Kappa Light Chain [+RPE] Antibodies Ray Biotech 0.5 mg 568 DS-PB-02285 Goat Anti-Human Kappa Light Chain [+RPE] Antibodies Ray Biotech 0.5 mg 568€
DS-PB-02286 Goat Anti-Human Kappa Light Chain [+Texas Red Ray Biotech 1 mg 502 DS-PB-02286 Goat Anti-Human Kappa Light Chain [+Texas Red Ray Biotech 1 mg 502€
DS-PB-02288 Goat Anti-Human Kinesin Heavy Chain (C-term.) Antibodies Ray Biotech 0.1 mg 502 DS-PB-02288 Goat Anti-Human Kinesin Heavy Chain (C-term.) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02289 Goat Anti-Human Ku80 XRCC5 Antibodies Ray Biotech 0.1 mg 502 DS-PB-02289 Goat Anti-Human Ku80 XRCC5 Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02290 Goat Anti-Human Lambda Light Chain [+Biotin] Antibodies Ray Biotech 1 mg 502 DS-PB-02290 Goat Anti-Human Lambda Light Chain [+Biotin] Antibodies Ray Biotech 1 mg 502€
DS-PB-02291 Goat Anti-Human Lambda Light Chain [+FITC] Antibodies Ray Biotech 1 mg 353 DS-PB-02291 Goat Anti-Human Lambda Light Chain [+FITC] Antibodies Ray Biotech 1 mg 353€
DS-PB-02292 Goat Anti-Human Lambda Light Chain [+HRP] Antibodies Ray Biotech 1 ml 328 DS-PB-02292 Goat Anti-Human Lambda Light Chain [+HRP] Antibodies Ray Biotech 1 ml 328€
DS-PB-02293 Goat Anti-Human Lambda Light Chain [+RPE] Antibodies Ray Biotech 0.5 mg 601 DS-PB-02293 Goat Anti-Human Lambda Light Chain [+RPE] Antibodies Ray Biotech 0.5 mg 601€
DS-PB-02294 Goat Anti-Human Lambda Light Chain [+Texas Red Ray Biotech 1 mg 502 DS-PB-02294 Goat Anti-Human Lambda Light Chain [+Texas Red Ray Biotech 1 mg 502€
DS-PB-02295 Goat Anti-Human Lambda Light Chain (+TRITC) Antibodies Ray Biotech 1 mg 502 DS-PB-02295 Goat Anti-Human Lambda Light Chain (+TRITC) Antibodies Ray Biotech 1 mg 502€
DS-PB-02296 Goat Anti-Human LEF1 Antibodies Ray Biotech 0.1 mg 502 DS-PB-02296 Goat Anti-Human LEF1 Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02297 Goat Anti-Human Leptin Receptor Antibodies Ray Biotech 0.1 mg 502 DS-PB-02297 Goat Anti-Human Leptin Receptor Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02298 Goat Anti-Human MADH2 Antibodies Ray Biotech 0.1 mg 584 DS-PB-02298 Goat Anti-Human MADH2 Antibodies Ray Biotech 0.1 mg 584€
DS-PB-02299 Goat Anti-Human MAX Antibodies Ray Biotech 0.1 mg 518 DS-PB-02299 Goat Anti-Human MAX Antibodies Ray Biotech 0.1 mg 518€
DS-PB-02300 Goat Anti-Human MELK (C-term) Antibodies Ray Biotech 0.1 mg 518 DS-PB-02300 Goat Anti-Human MELK (C-term) Antibodies Ray Biotech 0.1 mg 518€
DS-PB-02301 Goat Anti-Human Moesin Antibodies Ray Biotech 0.1 mg 502 DS-PB-02301 Goat Anti-Human Moesin Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02302 Goat Anti-Human MSH6 Antibodies Ray Biotech 50 411 DS-PB-02302 Goat Anti-Human MSH6 Antibodies Ray Biotech 50 411€
DS-PB-02303 Goat Anti-Human NCF1 Antibodies Ray Biotech 0.1 mg 733 DS-PB-02303 Goat Anti-Human NCF1 Antibodies Ray Biotech 0.1 mg 733€
DS-PB-02304 Goat Anti-Human Orexin Receptor-1 Antibodies Ray Biotech 0.1 mg 502 DS-PB-02304 Goat Anti-Human Orexin Receptor-1 Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02305 Goat Anti-Human p70S6K (C-term) Antibodies Ray Biotech 0.1 mg 502 DS-PB-02305 Goat Anti-Human p70S6K (C-term) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02306 Goat Anti-Human PAI-1 Antibodies Ray Biotech 0.1 mg 502 DS-PB-02306 Goat Anti-Human PAI-1 Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02307 Goat Anti-Human Peroxiredoxin 2 (C-term) Antibodies Ray Biotech 0.1 mg 502 DS-PB-02307 Goat Anti-Human Peroxiredoxin 2 (C-term) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02309 Goat Anti-Human PPAR delta (C-term) Antibodies Ray Biotech 0.1 mg 502 DS-PB-02309 Goat Anti-Human PPAR delta (C-term) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02311 Goat Anti-Human RAD51C (N-term) Antibodies Ray Biotech 0.1 mg 502 DS-PB-02311 Goat Anti-Human RAD51C (N-term) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02312 Goat Anti-Human Radixin Antibodies Ray Biotech 0.1 mg 502 DS-PB-02312 Goat Anti-Human Radixin Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02315 Goat Anti-Human SHP1 Antibodies Ray Biotech 0.1 mg 502 DS-PB-02315 Goat Anti-Human SHP1 Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02317 Goat Anti-Human SLP-76 (N-term) Antibodies Ray Biotech 0.1 mg 510 DS-PB-02317 Goat Anti-Human SLP-76 (N-term) Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02322 Goat Anti-Human TNF-alpha Antibodies Ray Biotech 0.1 mg 510 DS-PB-02322 Goat Anti-Human TNF-alpha Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02323 Goat Anti-Human TNF-alpha [+Biotin] Antibodies Ray Biotech 50 510 DS-PB-02323 Goat Anti-Human TNF-alpha [+Biotin] Antibodies Ray Biotech 50 510€
DS-PB-02324 Goat Anti-Human TRADD (isoform2) Antibodies Ray Biotech 0.1 mg 510 DS-PB-02324 Goat Anti-Human TRADD (isoform2) Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02325 Goat Anti-Human TRIM5 alpha (N-term) Antibodies Ray Biotech 0.1 mg 502 DS-PB-02325 Goat Anti-Human TRIM5 alpha (N-term) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02327 Goat Anti-Human VDR Antibodies Ray Biotech 0.1 mg 411 DS-PB-02327 Goat Anti-Human VDR Antibodies Ray Biotech 0.1 mg 411€
DS-PB-02328 Goat Anti-Human VEGF VEGF-A Antibodies Ray Biotech 0.1 mg 510 DS-PB-02328 Goat Anti-Human VEGF VEGF-A Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02329 Goat Anti-Human IRAK4 (N-term.) Antibodies Ray Biotech 0.1 mg 411 DS-PB-02329 Goat Anti-Human IRAK4 (N-term.) Antibodies Ray Biotech 0.1 mg 411€
DS-PB-02330 Goat Anti-Human ITK (C-term) Antibodies Ray Biotech 0.1 mg 518 DS-PB-02330 Goat Anti-Human ITK (C-term) Antibodies Ray Biotech 0.1 mg 518€
DS-PB-02335 Goat Anti-Human PICK1 Antibodies Ray Biotech 0.1 mg 502 DS-PB-02335 Goat Anti-Human PICK1 Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02336 Goat Anti-Human PITP alpha (C-term) Antibodies Ray Biotech 0.1 mg 510 DS-PB-02336 Goat Anti-Human PITP alpha (C-term) Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02338 Goat Anti-Human PUM1 Antibodies Ray Biotech 50 411 DS-PB-02338 Goat Anti-Human PUM1 Antibodies Ray Biotech 50 411€
DS-PB-02339 Goat Anti-Human RAB11A (C-term) Antibodies Ray Biotech 0.1 mg 502 DS-PB-02339 Goat Anti-Human RAB11A (C-term) Antibodies Ray Biotech 0.1 mg 502€
DS-PB-02341 Goat Anti-Human RBP1-Like Protein Antibodies Ray Biotech 0.1 mg 568 DS-PB-02341 Goat Anti-Human RBP1-Like Protein Antibodies Ray Biotech 0.1 mg 568€
DS-PB-02343 Goat Anti-Human STAT3 Antibodies Ray Biotech 0.1 mg 510 DS-PB-02343 Goat Anti-Human STAT3 Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02344 Goat Anti-Human SYK Antibodies Ray Biotech 0.1 mg 510 DS-PB-02344 Goat Anti-Human SYK Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02345 Goat Anti-Human TBL1X Antibodies Ray Biotech 0.1 mg 510 DS-PB-02345 Goat Anti-Human TBL1X Antibodies Ray Biotech 0.1 mg 510€
DS-PB-02767 Rabbit Anti-Human TLR5 Antibodies Ray Biotech 50 386 DS-PB-02767 Rabbit Anti-Human TLR5 Antibodies Ray Biotech 50 386€
ER-14-0061 Goat Anti-Human 14-3-3 sigma Stratifin, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0061 Goat Anti-Human 14-3-3 sigma Stratifin, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0062 Goat Anti-Human 14-3-3 tau YWHAQ, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0062 Goat Anti-Human 14-3-3 tau YWHAQ, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0064 Goat Anti-Human 4E-T EIF4ENIF1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0064 Goat Anti-Human 4E-T EIF4ENIF1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0069 Goat Anti-Human ABCB5, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0069 Goat Anti-Human ABCB5, (internal region) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0070 Goat Anti-Human ABCB9 TAPL, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0070 Goat Anti-Human ABCB9 TAPL, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0071 Goat Anti-Human, Rat ABCC4 MRP4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0071 Goat Anti-Human, Rat ABCC4 MRP4, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0073 Goat Anti-Human ABCE1 RNAse L inhibitor, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0073 Goat Anti-Human ABCE1 RNAse L inhibitor, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0077 Goat Anti-Human ACACB, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0077 Goat Anti-Human ACACB, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0078 Goat Anti-Human ACADM, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0078 Goat Anti-Human ACADM, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0079 Goat Anti-Human ACHE, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0079 Goat Anti-Human ACHE, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0080 Goat Anti-Human ACOX2, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0080 Goat Anti-Human ACOX2, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0083 Goat Anti-Human ACSL5, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0083 Goat Anti-Human ACSL5, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0084 Goat Anti-Human, Mouse, Rat, Pig Smooth muscle alpha-actin, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0084 Goat Anti-Human, Mouse, Rat, Pig Smooth muscle alpha-actin, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0085 Goat Anti-Human Actin-like 7B, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0085 Goat Anti-Human Actin-like 7B, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0087 Goat Anti-Human Activin receptor-like kinase 1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0087 Goat Anti-Human Activin receptor-like kinase 1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0088 Goat Anti-Human ACVR1, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0088 Goat Anti-Human ACVR1, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0089 Goat Anti-Human Acylglycerol kinase, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0089 Goat Anti-Human Acylglycerol kinase, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0091 Goat Anti-Human ADAM12, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0091 Goat Anti-Human ADAM12, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0092 Goat Anti-Human ADAM33, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0092 Goat Anti-Human ADAM33, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0095 Goat Anti-Human Adenosine A2b Receptor, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0095 Goat Anti-Human Adenosine A2b Receptor, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0096 Goat Anti-Human, Mouse, Rat ADH5, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0096 Goat Anti-Human, Mouse, Rat ADH5, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0103 Goat Anti-Human AGR2, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0103 Goat Anti-Human AGR2, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0107 Goat Anti-Human AIBZIP CREB3L4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0107 Goat Anti-Human AIBZIP CREB3L4, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0108 Goat Anti-Human AID, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0108 Goat Anti-Human AID, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0111 Goat Anti-Human AIF1 IBA1 (isoforms 1 + 3), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0111 Goat Anti-Human AIF1 IBA1 (isoforms 1 + 3), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0116 Goat Anti-Human AIRE (isoforms 1 and 2), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0116 Goat Anti-Human AIRE (isoforms 1 and 2), (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0120 Goat Anti-Human AKAP3 SOB1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0120 Goat Anti-Human AKAP3 SOB1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0122 Goat Anti-Human AKAP8 AKAP95, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0122 Goat Anti-Human AKAP8 AKAP95, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0123 Goat Anti-Human AKAP9 AKAP450 CG-NAP, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0123 Goat Anti-Human AKAP9 AKAP450 CG-NAP, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0124 Goat Anti-Human AKR1B10, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0124 Goat Anti-Human AKR1B10, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0126 Goat Anti-Human AKR1C4, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0126 Goat Anti-Human AKR1C4, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0127 Goat Anti-Human Aldehyde Reductase, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0127 Goat Anti-Human Aldehyde Reductase, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0128 Goat Anti-Human, Mouse, Rat ALDH1A1 (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0128 Goat Anti-Human, Mouse, Rat ALDH1A1 (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0129 Goat Anti-Human ALDH1A1 (Internal), (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0129 Goat Anti-Human ALDH1A1 (Internal), (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0130 Goat Anti-Human, Mouse CSN2 TRIP15, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0130 Goat Anti-Human, Mouse CSN2 TRIP15, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0131 Goat Anti-Human ALMS1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0131 Goat Anti-Human ALMS1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0132 Goat Anti-Human Alpha2-antiplasmin, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0132 Goat Anti-Human Alpha2-antiplasmin, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0133 Goat Anti-Human ALS2CR1 NIF3L1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0133 Goat Anti-Human ALS2CR1 NIF3L1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0134 Goat Anti-Human ALS2CR2 ILPIP, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0134 Goat Anti-Human ALS2CR2 ILPIP, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0136 Goat Anti-Human Alsin ALS2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0136 Goat Anti-Human Alsin ALS2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0138 Goat Anti-Human Aminopeptidase A, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0138 Goat Anti-Human Aminopeptidase A, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0139 Goat Anti-Human Amisyn STXBP6, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0139 Goat Anti-Human Amisyn STXBP6, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0142 Goat Anti-Human, Mouse Amphiphysin AMPH, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0142 Goat Anti-Human, Mouse Amphiphysin AMPH, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0144 Goat Anti-Human ANILLIN Scraps (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0144 Goat Anti-Human ANILLIN Scraps (C Terminus), (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0145 Goat Anti-Human, Mouse ANILLIN Scraps (internal), (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0145 Goat Anti-Human, Mouse ANILLIN Scraps (internal), (internal region) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0146 Goat Anti-Human Annexin A10 Annexin 14, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0146 Goat Anti-Human Annexin A10 Annexin 14, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0147 Goat Anti-Human Annexin A11, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0147 Goat Anti-Human Annexin A11, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0149 Goat Anti-Human AOC3, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0149 Goat Anti-Human AOC3, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353€
ER-14-0150 Goat Anti-Human AP-2 gamma, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0150 Goat Anti-Human AP-2 gamma, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0151 Goat Anti-Human APBA1 MINT1, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0151 Goat Anti-Human APBA1 MINT1, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0152 Goat Anti-Human, Mouse APBB1 FE65, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0152 Goat Anti-Human, Mouse APBB1 FE65, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0153 Goat Anti-Human APH1A, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0153 Goat Anti-Human APH1A, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0154 Goat Anti-Human APOA4, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353 ER-14-0154 Goat Anti-Human APOA4, (internal region (near the C Terminus)) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0156 Goat Anti-Human APOBEC2 (aa180 - 190), (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0156 Goat Anti-Human APOBEC2 (aa180 - 190), (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0159 Goat Anti-Human APOC1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0159 Goat Anti-Human APOC1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0160 Goat Anti-Human APOE, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0160 Goat Anti-Human APOE, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0162 Goat Anti-Human APOM, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0162 Goat Anti-Human APOM, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0165 Goat Anti-Human, Rat Arachidonate 5-lipoxygenase, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0165 Goat Anti-Human, Rat Arachidonate 5-lipoxygenase, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0166 Goat Anti-Human ARF1, 2, 3, 4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0166 Goat Anti-Human ARF1, 2, 3, 4, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0168 Goat Anti-Human, Mouse Arginase, type 1 ARG1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0168 Goat Anti-Human, Mouse Arginase, type 1 ARG1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0170 Goat Anti-Human, Cow Argininosuccinate synthetase 1, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0170 Goat Anti-Human, Cow Argininosuccinate synthetase 1, (internal region) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0171 Goat Anti-Human ARHGEF4, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0171 Goat Anti-Human ARHGEF4, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0173 Goat Anti-Human ARIH1 HHARI, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0173 Goat Anti-Human ARIH1 HHARI, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0174 Goat Anti-Human, Mouse ARIH2 TRIAD1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0174 Goat Anti-Human, Mouse ARIH2 TRIAD1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0175 Goat Anti-Human ARL2, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0175 Goat Anti-Human ARL2, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0176 Goat Anti-Human ARL4A, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0176 Goat Anti-Human ARL4A, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0177 Goat Anti-Human ARMET, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0177 Goat Anti-Human ARMET, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0178 Goat Anti-Human, Rat ARNO cytohesin 2, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0178 Goat Anti-Human, Rat ARNO cytohesin 2, (N Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0179 Goat Anti-Human Aromatase CYP19A1, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0179 Goat Anti-Human Aromatase CYP19A1, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0180 Goat Anti-Human ARP1 homolog A, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0180 Goat Anti-Human ARP1 homolog A, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0181 Goat Anti-Human ARP1 homolog B, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0181 Goat Anti-Human ARP1 homolog B, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0182 Goat Anti-Human ARP2 3 subunit 1B, (N Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0182 Goat Anti-Human ARP2 3 subunit 1B, (N Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0184 Goat Anti-Human, Mouse ARPC3, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0184 Goat Anti-Human, Mouse ARPC3, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0185 Goat Anti-Human, Mouse, Rat Arrestin beta 2, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0185 Goat Anti-Human, Mouse, Rat Arrestin beta 2, (internal region) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0187 Goat Anti-Human Arylsulfatase B, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0187 Goat Anti-Human Arylsulfatase B, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0188 Goat Anti-Human Arylsulfatase C STS, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0188 Goat Anti-Human Arylsulfatase C STS, (internal region) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0189 Goat Anti-Human AS160 TBC1D4, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0189 Goat Anti-Human AS160 TBC1D4, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0190 Goat Anti-Human ASF1A, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0190 Goat Anti-Human ASF1A, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0191 Goat Anti-Human ASF1A HSPC146, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0191 Goat Anti-Human ASF1A HSPC146, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0192 Goat Anti-Human, Mouse Asporin ASPN, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0192 Goat Anti-Human, Mouse Asporin ASPN, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0193 Goat Anti-Human ASRGL1 ALP, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0193 Goat Anti-Human ASRGL1 ALP, (internal region) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0196 Goat Anti-Human, Mouse ATF4, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0196 Goat Anti-Human, Mouse ATF4, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0198 Goat Anti-Human ATF7, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0198 Goat Anti-Human ATF7, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0199 Goat Anti-Human ATGL Desnutrin, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0199 Goat Anti-Human ATGL Desnutrin, (internal region) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0201 Goat Anti-Human ATP13A1, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0201 Goat Anti-Human ATP13A1, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0202 Goat Anti-Human, Mouse, Rat ATP6IP2 Renin receptor, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0202 Goat Anti-Human, Mouse, Rat ATP6IP2 Renin receptor, (C Terminus) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0203 Goat Anti-Human, Mouse, Rat AVPR1A, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0203 Goat Anti-Human, Mouse, Rat AVPR1A, (internal region) Antibodies Ray Biotech 100 μg 353€ Pub
ER-14-0204 Goat Anti-Human AVPR1B, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0204 Goat Anti-Human AVPR1B, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0206 Goat Anti-Human AXIN1, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0206 Goat Anti-Human AXIN1, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0207 Goat Anti-Human B3GNT2, (internal region) Antibodies Ray Biotech 100 μg 353 ER-14-0207 Goat Anti-Human B3GNT2, (internal region) Antibodies Ray Biotech 100 μg 353€
ER-14-0208 Goat Anti-Human B5 Receptor PCID1 EIF3M, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0208 Goat Anti-Human B5 Receptor PCID1 EIF3M, (C Terminus) Antibodies Ray Biotech 100 μg 353€
ER-14-0209 Goat Anti-Human B56 beta isoform, (C Terminus) Antibodies Ray Biotech 100 μg 353 ER-14-0209 Goat Anti-Human B56 beta isoform, (C Terminus) Antibodies Ray Biotech 100 μg 353€
  Cat_Number Product name Supplier Quantity Price PDF Pub