Product name :Blue Fluorescence Protein (BFP)100 ug

Catalog Number :4994-100

Quantity :100 ug

Price :288 Eur

Pay now with :

Supplier :Biovision

 

Alternate Names / Synonyms: BFP

Gene Symbol:

Accession #:

Gene ID:

Source: E. coli

Appearance: Lyophilized protein

Physical Form Description: Freeze Dried

Molecular Weight: 29.0 kDa

Purity by SDS-PAGE: ≥97%

Purity by HPLC: ≥97%

Endotoxin Level: <0.1 ng/μg

Biological Activity: N/A

Reconstitution Instructions: Reconstitute with dH₂O to 1 mg/ml

Storage Temp.: -20°C

Shipping: Gel pack

Background Information: The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. BFP protein sequence:MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV LLEFVTAAGITLGMDELYK

Handling: Centrifuge the vial prior to opening.

Usage: For Research Use Only! Not to be used in humans.

datasheet of product :Blue Fluorescence Protein (BFP)100 ug Blue Fluorescence Protein (BFP)100 ug

Question about this product?

Name

Email Address

Message

Retype code:

random val Reload Image


[Related Products]Blue Fluorescence Protein (BFP)100 ug

Filter: (Type enter to validate)
  Cat_Number Product name Supplier Quantity Price Tech More
4994-100 Blue Fluorescence Protein (BFP)100 ug Biovision 100 ug 288 4994-100 Blue Fluorescence Protein (BFP)100 ug Biovision 100 ug 288€ Pub
4993-100 mCherry Fluorescence Protein100 ug Biovision 100 ug 288 4993-100 mCherry Fluorescence Protein100 ug Biovision 100 ug 288€ Pub
4994-1000 Blue Fluorescence Protein (BFP) Biovision 1 mg 2125 4994-1000 Blue Fluorescence Protein (BFP) Biovision 1 mg 2125€ Pub
00700-V HTLV 1 gp21 recombinant protein Virogen 100 ug/vial 225 00700-V HTLV 1 gp21 recombinant protein Virogen 100 ug/vial 225€
ASK
Pub
01-008 E.coli RuvA Protein B-Bridge 100 ug 1199.1 01-008 E.coli RuvA Protein B-Bridge 100 ug 1199.1€
ASK
Pub
01-008 E.coli RuvA Protein E.coli RuvA Protein B-Bridge 100 ug 1212.75 01-008 E.coli RuvA Protein E.coli RuvA Protein B-Bridge 100 ug 1212.75€
ASK
Pub
01-010 E.coli RuvB Protein B-Bridge 100 ug 1199.1 01-010 E.coli RuvB Protein B-Bridge 100 ug 1199.1€
ASK
Pub
01-010 E.coli RuvB Protein E.coli RuvB Protein B-Bridge 100 ug 1212.75 01-010 E.coli RuvB Protein E.coli RuvB Protein B-Bridge 100 ug 1212.75€
ASK
Pub
01-012 E.coli RuvC Protein B-Bridge 100 ug 1199.1 01-012 E.coli RuvC Protein B-Bridge 100 ug 1199.1€
ASK
Pub
01-012 E.coli RuvC Protein E.coli RuvC Protein B-Bridge 100 ug 1212.75 01-012 E.coli RuvC Protein E.coli RuvC Protein B-Bridge 100 ug 1212.75€
ASK
Pub
02-044 Taq SSB (Single Stranded DNA Binding) protein B-Bridge 100 ug 257.25 02-044 Taq SSB (Single Stranded DNA Binding) protein B-Bridge 100 ug 257.25€
ASK
Pub
02-044 Taq SSB (Single Stranded DNA Binding) protein Taq SSB (Single Stranded DNA Binding) protein B-Bridge 100 ug 201.6 02-044 Taq SSB (Single Stranded DNA Binding) protein Taq SSB (Single Stranded DNA Binding) protein B-Bridge 100 ug 201.6€
ASK
Pub
02-048 Taq RecA protein B-Bridge 100 ug 154.875 02-048 Taq RecA protein B-Bridge 100 ug 154.875€
ASK
Pub
02-048 Taq RecA protein Taq RecA protein B-Bridge 100 ug 100.8 02-048 Taq RecA protein Taq RecA protein B-Bridge 100 ug 100.8€
ASK
Pub
0304 I27O™ AFM Reference Protein, 100 ug Athena 100ìg 354 0304 I27O™ AFM Reference Protein, 100 ug Athena 100ìg 354€
ASK
Pub
039-A anti FAS IgG1 (monoclonal) Produced against a recombinant protein. Recognition human, rat, mouse Clone GH 9 Virogen 100 ug/vial 225 039-A anti FAS IgG1 (monoclonal) Produced against a recombinant protein. Recognition human, rat, mouse Clone GH 9 Virogen 100 ug/vial 225€
ASK
Pub
10-002 Rad51 Protein (Human) B-Bridge 100 ug 1199.1 10-002 Rad51 Protein (Human) B-Bridge 100 ug 1199.1€
ASK
Pub
10-002 Rad51 Protein (Human) Rad51 Protein (Human) B-Bridge 100 ug 1212.75 10-002 Rad51 Protein (Human) Rad51 Protein (Human) B-Bridge 100 ug 1212.75€
ASK
Pub
10-004 Rad52 Protein (Human) B-Bridge 100 ug 890.116 10-004 Rad52 Protein (Human) B-Bridge 100 ug 890.116€
ASK
Pub
10-004 Rad52 Protein (Human) Rad52 Protein (Human) B-Bridge 100 ug 910.35 10-004 Rad52 Protein (Human) Rad52 Protein (Human) B-Bridge 100 ug 910.35€
ASK
Pub
11100 Amplite™ Fluorimetric Fluorescamine Protein Quantitation Kit *Blue Fluorescence* AAT Bioquest 1 kit 124 11100 Amplite™ Fluorimetric Fluorescamine Protein Quantitation Kit *Blue Fluorescence* AAT Bioquest 1 kit 124€
ASK
Pub
16935 mFluor™ Blue 570-streptavidin conjugate *1 mg ml* AAT Bioquest 100 ug 124 16935 mFluor™ Blue 570-streptavidin conjugate *1 mg ml* AAT Bioquest 100 ug 124€
ASK
Pub
21332 Niban like protein 1(Ab 712) antibody Host Species Rabbit polyclonal SignalWay Antibody S.A.B 100 ug 197 21332 Niban like protein 1(Ab 712) antibody Host Species Rabbit polyclonal SignalWay Antibody S.A.B 100 ug 197€
ASK
Pub
308-10381 Anti Galectin(Gal 3) Human, Polyclonal Antibody, Rabbit The galectins are a family of carbohydrate binding proteins that are distributed widely in  metazoan organisms. Many galectin family members are B-Bridge 100 UG 854.7 308-10381 Anti Galectin(Gal 3) Human, Polyclonal Antibody, Rabbit The galectins are a family of carbohydrate binding proteins that are distributed widely in  metazoan organisms. Many galectin family members are B-Bridge 100 UG 854.7€
ASK
Pub
30R-2097 FGF2 protein, Native & Recombinant Proteins Fitzgerald 100 ug 906 30R-2097 FGF2 protein, Native & Recombinant Proteins Fitzgerald 100 ug 906€
ASK
Pub
3544-100 Proteinase Inhibitor 9 (PI9) mAb100 ug Biovision 100 ug 325.08 3544-100 Proteinase Inhibitor 9 (PI9) mAb100 ug Biovision 100 ug 325.08€
ASK
Pub
3544R-100 Proteinase Inhibitor 9 (PI9) pAb100 ug Biovision 100 ug 257.985 3544R-100 Proteinase Inhibitor 9 (PI9) pAb100 ug Biovision 100 ug 257.985€
ASK
Pub
3992-100 Green Fluorescence Protein (GFP) Antibody (Clone BV-F4) Biovision 100 353 3992-100 Green Fluorescence Protein (GFP) Antibody (Clone BV-F4) Biovision 100 353€
ASK
Pub
4994-5000 Blue Fluorescent Protein (BFP) Biovision 5 mg 5405 4994-5000 Blue Fluorescent Protein (BFP) Biovision 5 mg 5405€ Pub
4998-100 Yellow Fluorescent Protein Biovision 100 ug 380 4998-100 Yellow Fluorescent Protein Biovision 100 ug 380€ Pub
5601-100 PDI (Protein Disulfide Isomerase) Antibody100 ug Biovision 100 ug 258 5601-100 PDI (Protein Disulfide Isomerase) Antibody100 ug Biovision 100 ug 258€ Pub
60 Nile Blue A *Fluorescence reference standard* AAT Bioquest 100 mg 108 60 Nile Blue A *Fluorescence reference standard* AAT Bioquest 100 mg 108€
ASK
Pub
60-001 anti GFP antibody, rat monoclonal The green fluorescent protein (GFP) is composed of 238 amino acids (26.9 kDa), originally isolated from the jellyfish Aequorea victoria that fluoresces green when exp B-Bridge 100 ug 0 60-001 anti GFP antibody, rat monoclonal The green fluorescent protein (GFP) is composed of 238 amino acids (26.9 kDa), originally isolated from the jellyfish Aequorea victoria that fluoresces green when exp B-Bridge 100 ug 0€
ASK
Pub
6504-01 Protein A G FITC100 ug Biovision 100 ug 183 6504-01 Protein A G FITC100 ug Biovision 100 ug 183€
ASK
Pub
6506-01 Protein A G Biotin100 ug Biovision 100 ug 183 6506-01 Protein A G Biotin100 ug Biovision 100 ug 183€
ASK
Pub
6512-100 Protein G Biotin100 ug Biovision 100 ug 137 6512-100 Protein G Biotin100 ug Biovision 100 ug 137€
ASK
Pub
7001-100 c Jun (1 79) GST Fusion Protein100 ug Biovision 100 ug 145 7001-100 c Jun (1 79) GST Fusion Protein100 ug Biovision 100 ug 145€
ASK
Pub
7003-100 GSK 3a GST Fusion Protein100 ug Biovision 100 ug 145 7003-100 GSK 3a GST Fusion Protein100 ug Biovision 100 ug 145€
ASK
Pub
7601-100 Protein Disulfide Isomerase (PDI)100 ug Biovision 100 ug 325 7601-100 Protein Disulfide Isomerase (PDI)100 ug Biovision 100 ug 325€
ASK
Pub
7603-100 DNA Binding Protein 7 (DBP 7), human recombinant Biovision 100 ug 687 7603-100 DNA Binding Protein 7 (DBP 7), human recombinant Biovision 100 ug 687€ Pub
hAP-0093 Mouse anti human Angiopoietin like protein 7 Anti-Human antibodies AngoiPro 100.00 ug 310 hAP-0093 Mouse anti human Angiopoietin like protein 7 Anti-Human antibodies AngoiPro 100.00 ug 310€ Pub
hAP-0297 Rat anti human Follistatin like-protein 1 Anti-Human antibodies AngoiPro 100.00 ug 310 hAP-0297 Rat anti human Follistatin like-protein 1 Anti-Human antibodies AngoiPro 100.00 ug 310€ Pub
M0851 7 (Diethylamino)coumarin 3 carboxylic acid, Blue green fluorescent label for use in peptide and protein modification, 100mg MarkerGene 134 M0851 7 (Diethylamino)coumarin 3 carboxylic acid, Blue green fluorescent label for use in peptide and protein modification, 100mg MarkerGene 134€
ASK
Pub
mAP-0080 Rat monoclonal anti mouse FLRG (Follistatin-Related gene protein) Anti-Mouse antibodies AngoiPro 100.00 ug 310 mAP-0080 Rat monoclonal anti mouse FLRG (Follistatin-Related gene protein) Anti-Mouse antibodies AngoiPro 100.00 ug 310€ Pub
mAP-0084 Rat monoclonal anti mouse Gas6 (growth arrest specific protein 6) Anti-Mouse antibodies AngoiPro 100.00 ug 310 mAP-0084 Rat monoclonal anti mouse Gas6 (growth arrest specific protein 6) Anti-Mouse antibodies AngoiPro 100.00 ug 310€ Pub
mAP-0092 Rat monoclonal anti mouse Hepatoma-derived growth factor, Related Protein 1 (HRP-1) Anti-Mouse antibodies AngoiPro 100.00 ug 310 mAP-0092 Rat monoclonal anti mouse Hepatoma-derived growth factor, Related Protein 1 (HRP-1) Anti-Mouse antibodies AngoiPro 100.00 ug 310€ Pub
mAP-0094 Rat monoclonal anti mouse insulin-like growth factor binding protein 1 (IGFBP-1) Anti-Mouse antibodies AngoiPro 100.00 ug 310 mAP-0094 Rat monoclonal anti mouse insulin-like growth factor binding protein 1 (IGFBP-1) Anti-Mouse antibodies AngoiPro 100.00 ug 310€ Pub
mAP-0095 Rat monoclonal anti mouse insulin-like growth factor binding protein 1 (IGFBP-2) Anti-Mouse antibodies AngoiPro 100.00 ug 310 mAP-0095 Rat monoclonal anti mouse insulin-like growth factor binding protein 1 (IGFBP-2) Anti-Mouse antibodies AngoiPro 100.00 ug 310€ Pub
mAP-0096 Rat monoclonal anti mouse insulin-like growth factor binding protein 1 (IGFBP-3) Anti-Mouse antibodies AngoiPro 100.00 ug 310 mAP-0096 Rat monoclonal anti mouse insulin-like growth factor binding protein 1 (IGFBP-3) Anti-Mouse antibodies AngoiPro 100.00 ug 310€ Pub
mAP-0097 Rat monoclonal anti mouse insulin-like growth factor binding protein 1 (IGFBP-5) Anti-Mouse antibodies AngoiPro 100.00 ug 310 mAP-0097 Rat monoclonal anti mouse insulin-like growth factor binding protein 1 (IGFBP-5) Anti-Mouse antibodies AngoiPro 100.00 ug 310€ Pub
mAP-0098 Rat monoclonal anti mouse insulin-like growth factor binding protein 1 (IGFBP-6) Anti-Mouse antibodies AngoiPro 100.00 ug 310 mAP-0098 Rat monoclonal anti mouse insulin-like growth factor binding protein 1 (IGFBP-6) Anti-Mouse antibodies AngoiPro 100.00 ug 310€ Pub
mAP-0118 Rat monoclonal anti mouse Kell (blood group protein, CD238) Anti-Mouse antibodies AngoiPro 100.00 ug 310 mAP-0118 Rat monoclonal anti mouse Kell (blood group protein, CD238) Anti-Mouse antibodies AngoiPro 100.00 ug 310€ Pub
mAP-0130 Rat monoclonal anti mouse Secreted protein acidic and rich in cysteine (SPARC) Anti-Mouse antibodies AngoiPro 100.00 ug 310 mAP-0130 Rat monoclonal anti mouse Secreted protein acidic and rich in cysteine (SPARC) Anti-Mouse antibodies AngoiPro 100.00 ug 310€ Pub
mAP-0152 Rat monoclonal anti mouse Angiopoietin-like protein 2 Anti-Mouse antibodies AngoiPro 100.00 ug 310 mAP-0152 Rat monoclonal anti mouse Angiopoietin-like protein 2 Anti-Mouse antibodies AngoiPro 100.00 ug 310€ Pub
mAP-0153 Rat monoclonal anti mouse Angiopoietin-like protein 3 Anti-Mouse antibodies AngoiPro 100.00 ug 310 mAP-0153 Rat monoclonal anti mouse Angiopoietin-like protein 3 Anti-Mouse antibodies AngoiPro 100.00 ug 310€ Pub
rAP-0043-100 IGF-1 (Human) recombinant proteins AngoiPro 100.00 ug 279 rAP-0043-100 IGF-1 (Human) recombinant proteins AngoiPro 100.00 ug 279€ Pub
rAP-0044-100 IGF-1 Des1-3 (Human) recombinant proteins AngoiPro 100.00 ug 279 rAP-0044-100 IGF-1 Des1-3 (Human) recombinant proteins AngoiPro 100.00 ug 279€
ASK
Pub
UCP23-P Human Uncoupling Protein 2 (UCP2) Control blocking peptide 3 Alpha Diagnostics 100 ug 190 UCP23-P Human Uncoupling Protein 2 (UCP2) Control blocking peptide 3 Alpha Diagnostics 100 ug 190€
ASK
Pub
Y102958 Bone Morphogenetic Protein 4 (BMP-4) Antibody ABM Goods 100 ug 1220 Y102958 Bone Morphogenetic Protein 4 (BMP-4) Antibody ABM Goods 100 ug 1220€
ASK
Pub
Y102958 Bone Morphogenetic Protein 4 (BMP 4) ABM Goods 100 ug 1376 Y102958 Bone Morphogenetic Protein 4 (BMP 4) ABM Goods 100 ug 1376€
ASK
Pub
Y104487 Amyloid Precursor Protein (APP), C-Terminal Antibody ABM Goods 100 ug 1015.35 Y104487 Amyloid Precursor Protein (APP), C-Terminal Antibody ABM Goods 100 ug 1015.35€
ASK
Pub
Y104487 Amyloid Precursor Protein (APP), C Terminal ABM Goods 100 ug 1146.6 Y104487 Amyloid Precursor Protein (APP), C Terminal ABM Goods 100 ug 1146.6€
ASK
Pub
Y107966 Apoptosis Related Protein (ARTS), Human ABM Goods 100 ug 1146.6 Y107966 Apoptosis Related Protein (ARTS), Human ABM Goods 100 ug 1146.6€
ASK
Pub
Y107966 Apoptosis Related Protein (ARTS), Human Antibody ABM Goods 100 ug 1015.35 Y107966 Apoptosis Related Protein (ARTS), Human Antibody ABM Goods 100 ug 1015.35€
ASK
Pub
Y107967 ASC, A novel CARD-containing adaptor protein, Human Antibody ABM Goods 100 ug 1015.35 Y107967 ASC, A novel CARD-containing adaptor protein, Human Antibody ABM Goods 100 ug 1015.35€
ASK
Pub
Y107967 ASC, A novel CARD containing adaptor protein, Human ABM Goods 100 ug 1146.6 Y107967 ASC, A novel CARD containing adaptor protein, Human ABM Goods 100 ug 1146.6€
ASK
Pub
Y108141 BCMA (B cell maturation protein) ABM Goods 100 ug 1146.6 Y108141 BCMA (B cell maturation protein) ABM Goods 100 ug 1146.6€
ASK
Pub
Y108141 BCMA (B cell maturation protein) Antibody ABM Goods 100 ug 1015.35 Y108141 BCMA (B cell maturation protein) Antibody ABM Goods 100 ug 1015.35€
ASK
Pub
ABO999 Aniline Blue - Orange G Scy tek 1000 ml 120 ABO999 Aniline Blue - Orange G Scy tek 1000 ml 120€
ASK
Pub
ABP999 Aniline Blue Solution Scy tek 1000 ml 120 ABP999 Aniline Blue Solution Scy tek 1000 ml 120€
ASK
Pub
AFR-2 Alcian Blue (pH 2.5) Staining Kit Scy tek 100 Slides 100 AFR-2 Alcian Blue (pH 2.5) Staining Kit Scy tek 100 Slides 100€
ASK
Pub
AFT-2 Alcian Blue (pH 1.0) Stain Kit Scy tek 100 Slides 116 AFT-2 Alcian Blue (pH 1.0) Stain Kit Scy tek 100 Slides 116€
ASK
Pub
ANA999 Alcian Blue Solution, pH 1.0 Scy tek 1000 ml 211 ANA999 Alcian Blue Solution, pH 1.0 Scy tek 1000 ml 211€
ASK
Pub
ANC999 Alcian Blue Solution, pH 2.5 Scy tek 1000 ml 211 ANC999 Alcian Blue Solution, pH 2.5 Scy tek 1000 ml 211€
ASK
Pub
BCA999 Brilliant Cresyl Blue (0.3%, Alcoholic) Scy tek 1000 ml 139 BCA999 Brilliant Cresyl Blue (0.3%, Alcoholic) Scy tek 1000 ml 139€
ASK
Pub
BCS999 Brilliant Cresyl Blue (1.5% in 0.85% Saline) Scy tek 1000 ml 147 BCS999 Brilliant Cresyl Blue (1.5% in 0.85% Saline) Scy tek 1000 ml 147€
ASK
Pub
LBC-2 Luxol Fast Blue Stain Kit Scy tek 100 Slides 108 LBC-2 Luxol Fast Blue Stain Kit Scy tek 100 Slides 108€
ASK
Pub
LFB999 Luxol Fast Blue Solution Scy tek 1000 ml 139 LFB999 Luxol Fast Blue Solution Scy tek 1000 ml 139€
ASK
Pub
MBS999 Methylene Blue Solution (Loeffler's) Scy tek 1000 ml 139 MBS999 Methylene Blue Solution (Loeffler's) Scy tek 1000 ml 139€
ASK
Pub
TGB999 Trichrome Stain (Blue) Scy tek 1000 ml 128 TGB999 Trichrome Stain (Blue) Scy tek 1000 ml 128€
ASK
Pub
TQF999 Toludine Blue Solution Scy tek 1000 ml 162 TQF999 Toludine Blue Solution Scy tek 1000 ml 162€
ASK
Pub
00154-V HCV NS3 1359 1456aa antigen. The protein contains immunodominant regions (1359 1456aa). available genotypes 1a, 1b, 2b, 3, 4, 5, 6 Virogen 100 µg 280 00154-V HCV NS3 1359 1456aa antigen. The protein contains immunodominant regions (1359 1456aa). available genotypes 1a, 1b, 2b, 3, 4, 5, 6 Virogen 100 µg 280€
ASK
Pub
00900-V Allergens, Phospholipase A2 P00630 Bee Venom Recombinant Protein Virogen 100ug/vial 216 00900-V Allergens, Phospholipase A2 P00630 Bee Venom Recombinant Protein Virogen 100ug/vial 216€
ASK
Pub
01-001 E.coli RecA Protein B-Bridge 200 ug 195.825 01-001 E.coli RecA Protein B-Bridge 200 ug 195.825€
ASK
Pub
01-001 E.coli RecA Protein E.coli RecA Protein B-Bridge 200 ug 120.75 01-001 E.coli RecA Protein E.coli RecA Protein B-Bridge 200 ug 120.75€
ASK
Pub
01-007 E.coli RuvA Protein B-Bridge 20 ug 456.876 01-007 E.coli RuvA Protein B-Bridge 20 ug 456.876€
ASK
Pub
01-007 E.coli RuvA Protein E.coli RuvA Protein B-Bridge 20 ug 404.25 01-007 E.coli RuvA Protein E.coli RuvA Protein B-Bridge 20 ug 404.25€
ASK
Pub
01-009 E.coli RuvB Protein B-Bridge 20 ug 456.876 01-009 E.coli RuvB Protein B-Bridge 20 ug 456.876€
ASK
Pub
01-009 E.coli RuvB Protein E.coli RuvB Protein B-Bridge 20 ug 404.25 01-009 E.coli RuvB Protein E.coli RuvB Protein B-Bridge 20 ug 404.25€
ASK
Pub
01-011 E.coli RuvC Protein B-Bridge 20 ug 456.876 01-011 E.coli RuvC Protein B-Bridge 20 ug 456.876€
ASK
Pub
01-011 E.coli RuvC Protein E.coli RuvC Protein B-Bridge 20 ug 404.25 01-011 E.coli RuvC Protein E.coli RuvC Protein B-Bridge 20 ug 404.25€
ASK
Pub
011-A anti GSK3 Beta IgG2a (monoclonal). Produced against a recombinant Xenopus laevis protein. Virogen 100 µg 280 011-A anti GSK3 Beta IgG2a (monoclonal). Produced against a recombinant Xenopus laevis protein. Virogen 100 µg 280€
ASK
Pub
0114-A anti HIV 2 gp36 IgG1 (monoclonal) Produced against a recombinant protein. Virogen 100 µg 280 0114-A anti HIV 2 gp36 IgG1 (monoclonal) Produced against a recombinant protein. Virogen 100 µg 280€
ASK
Pub
013-A anti HIV 1 p55 17 IgG1 (monoclonal) Produced against a recombinant protein. Virogen 100 µg 280 013-A anti HIV 1 p55 17 IgG1 (monoclonal) Produced against a recombinant protein. Virogen 100 µg 280€
ASK
Pub
014-A anti HIV 1 p17 IgG1 (monoclonal) Produced against a recombinant protein Virogen 100 µg 280 014-A anti HIV 1 p17 IgG1 (monoclonal) Produced against a recombinant protein Virogen 100 µg 280€
ASK
Pub
018-A anti HCV NS4 IgG2a (monoclonal) Produced against a recombinant protein. Virogen 100 µg 280 018-A anti HCV NS4 IgG2a (monoclonal) Produced against a recombinant protein. Virogen 100 µg 280€
ASK
Pub
019-A anti FAS IgG1 (monoclonal) Produced against a recombinant protein. Virogen 100 µg 280 019-A anti FAS IgG1 (monoclonal) Produced against a recombinant protein. Virogen 100 µg 280€
ASK
Pub
02-040 T4 SSB (gene 32) protein B-Bridge 200 ug 154.875 02-040 T4 SSB (gene 32) protein B-Bridge 200 ug 154.875€
ASK
Pub
02-040 T4 SSB (gene 32) protein T4 SSB (gene 32) protein B-Bridge 200 ug 100.8 02-040 T4 SSB (gene 32) protein T4 SSB (gene 32) protein B-Bridge 200 ug 100.8€
ASK
Pub
02-040-5 T4 SSB (gene 32) protein B-Bridge 5 x 200 ug 410.812 02-040-5 T4 SSB (gene 32) protein B-Bridge 5 x 200 ug 410.812€
ASK
Pub
02-040-5 T4 SSB (gene 32) protein T4 SSB (gene 32) protein B-Bridge 5 x 200 ug 353.85 02-040-5 T4 SSB (gene 32) protein T4 SSB (gene 32) protein B-Bridge 5 x 200 ug 353.85€
ASK
Pub
02-042 E. coli SSB (Single Stranded DNA Binding) protein B-Bridge 200 ug 154.875 02-042 E. coli SSB (Single Stranded DNA Binding) protein B-Bridge 200 ug 154.875€
ASK
Pub
02-042 E. coli SSB (Single Stranded DNA Binding) protein E. coli SSB (Single Stranded DNA Binding) protein B-Bridge 200 ug 100.8 02-042 E. coli SSB (Single Stranded DNA Binding) protein E. coli SSB (Single Stranded DNA Binding) protein B-Bridge 200 ug 100.8€
ASK
Pub
02-042-5 E. coli SSB (Single Stranded DNA Binding) protein B-Bridge 5 x 200 ug 410.812 02-042-5 E. coli SSB (Single Stranded DNA Binding) protein B-Bridge 5 x 200 ug 410.812€
ASK
Pub
02-042-5 E. coli SSB (Single Stranded DNA Binding) protein E. coli SSB (Single Stranded DNA Binding) protein B-Bridge 5 x 200 ug 353.85 02-042-5 E. coli SSB (Single Stranded DNA Binding) protein E. coli SSB (Single Stranded DNA Binding) protein B-Bridge 5 x 200 ug 353.85€
ASK
Pub
02101-250 AccuRuller RGB Prestained Protein Ladders 250μl (100 loadings) Maestro 132.5 02101-250 AccuRuller RGB Prestained Protein Ladders 250μl (100 loadings) Maestro 132.5€
ASK
Pub
02102-250 AccuRuller RGB PLUS Prestained Protein Ladders 250μl (100 loadings) Maestro 135.1 02102-250 AccuRuller RGB PLUS Prestained Protein Ladders 250μl (100 loadings) Maestro 135.1€
ASK
Pub
023-14821 Bone Morphogenetic Protein 4 (BMP 4), Human, recombinant B-Bridge 5 ug 686.406 023-14821 Bone Morphogenetic Protein 4 (BMP 4), Human, recombinant B-Bridge 5 ug 686.406€
ASK
Pub
023-14821 Bone Morphogenetic Protein 4 (BMP 4), Human, recombinant Bone Morphogenetic Protein 4 (BMP 4), Human, recombinant B-Bridge 5 ug 467.25 023-14821 Bone Morphogenetic Protein 4 (BMP 4), Human, recombinant Bone Morphogenetic Protein 4 (BMP 4), Human, recombinant B-Bridge 5 ug 467.25€
ASK
Pub
026-14811 Bone Morphogenetic Protein 2 (BMP 2), Human, recombinant B-Bridge 5 ug 686.406 026-14811 Bone Morphogenetic Protein 2 (BMP 2), Human, recombinant B-Bridge 5 ug 686.406€
ASK
Pub
026-14811 Bone Morphogenetic Protein 2 (BMP 2), Human, recombinant Bone Morphogenetic Protein 2 (BMP 2), Human, recombinant B-Bridge 5 ug 467.25 026-14811 Bone Morphogenetic Protein 2 (BMP 2), Human, recombinant Bone Morphogenetic Protein 2 (BMP 2), Human, recombinant B-Bridge 5 ug 467.25€
ASK
Pub
10-001 Rad51 Protein (Human) B-Bridge 20 ug 424.777 10-001 Rad51 Protein (Human) B-Bridge 20 ug 424.777€
ASK
Pub
10-001 Rad51 Protein (Human) Rad51 Protein (Human) B-Bridge 20 ug 404.25 10-001 Rad51 Protein (Human) Rad51 Protein (Human) B-Bridge 20 ug 404.25€
ASK
Pub
10-003 Rad52 Protein (Human) B-Bridge 20 ug 331.706 10-003 Rad52 Protein (Human) B-Bridge 20 ug 331.706€
ASK
Pub
10-003 Rad52 Protein (Human) Rad52 Protein (Human) B-Bridge 20 ug 303.45 10-003 Rad52 Protein (Human) Rad52 Protein (Human) B-Bridge 20 ug 303.45€
ASK
Pub
1100 ReadiLink™ mFluor™ Violet 450 Protein Labeling Kit *Microscale Optimized for Labeling 100 µg Antibody Per Reaction* AAT Bioquest 1 kit 202 1100 ReadiLink™ mFluor™ Violet 450 Protein Labeling Kit *Microscale Optimized for Labeling 100 µg Antibody Per Reaction* AAT Bioquest 1 kit 202€
ASK
Pub
1105 ReadiLink™ mFluor™ Violet 420 Protein Labeling Kit *Microscale Optimized for Labeling 100 µg Antibody Per Reaction* AAT Bioquest 1 kit 202 1105 ReadiLink™ mFluor™ Violet 420 Protein Labeling Kit *Microscale Optimized for Labeling 100 µg Antibody Per Reaction* AAT Bioquest 1 kit 202€
ASK
Pub
1110 ReadiLink™ mFluor™ Violet 510 Protein Labeling Kit *Microscale Optimized for Labeling 100 µg Antibody Per Reaction* AAT Bioquest 1 kit 202 1110 ReadiLink™ mFluor™ Violet 510 Protein Labeling Kit *Microscale Optimized for Labeling 100 µg Antibody Per Reaction* AAT Bioquest 1 kit 202€
ASK
Pub
1114 ReadiLink™ mFluor™ Violet 540 Protein Labeling Kit *Microscale Optimized for Labeling 100 µg Antibody Per Reaction* AAT Bioquest 1 kit 202 1114 ReadiLink™ mFluor™ Violet 540 Protein Labeling Kit *Microscale Optimized for Labeling 100 µg Antibody Per Reaction* AAT Bioquest 1 kit 202€
ASK
Pub
11232 S6 Ribosomal Protein (Phospho Ser235) Antibody Host Species Rabbit polyclonal SignalWay Antibody S.A.B 50 ug 192 11232 S6 Ribosomal Protein (Phospho Ser235) Antibody Host Species Rabbit polyclonal SignalWay Antibody S.A.B 50 ug 192€
ASK
Pub
11952 Amplite™ Fluorimetric Alkaline Phosphatase Assay Kit *Blue Fluorescence* AAT Bioquest 1 kit 163 11952 Amplite™ Fluorimetric Alkaline Phosphatase Assay Kit *Blue Fluorescence* AAT Bioquest 1 kit 163€
ASK
Pub
1220 ReadiLink™ iFluor™ 350 Protein Labeling Kit *Microscale Optimized for Labeling 100 µg Antibody Per Reaction* AAT Bioquest 1 kit 202 1220 ReadiLink™ iFluor™ 350 Protein Labeling Kit *Microscale Optimized for Labeling 100 µg Antibody Per Reaction* AAT Bioquest 1 kit 202€
ASK
Pub
1230 ReadiLink™ iFluor™ 594 Protein Labeling Kit *Microscale Optimized for Labeling 100 µg Antibody Per Reaction* AAT Bioquest 1 kit 202 1230 ReadiLink™ iFluor™ 594 Protein Labeling Kit *Microscale Optimized for Labeling 100 µg Antibody Per Reaction* AAT Bioquest 1 kit 202€
ASK
Pub
1235 ReadiLink™ iFluor™ 647 Protein Labeling Kit *Microscale Optimized for Labeling 100 µg Antibody Per Reaction* AAT Bioquest 1 kit 202 1235 ReadiLink™ iFluor™ 647 Protein Labeling Kit *Microscale Optimized for Labeling 100 µg Antibody Per Reaction* AAT Bioquest 1 kit 202€
ASK
Pub
1245 ReadiLink™ iFluor™ 700 Protein Labeling Kit *Microscale Optimized for Labeling 100 µg Antibody Per Reaction* AAT Bioquest 1 kit 202 1245 ReadiLink™ iFluor™ 700 Protein Labeling Kit *Microscale Optimized for Labeling 100 µg Antibody Per Reaction* AAT Bioquest 1 kit 202€
ASK
Pub
12602 Amplite™ Fluorimetric Neuraminidase Assay Kit *Blue Fluorescence* AAT Bioquest 1 kit 280 12602 Amplite™ Fluorimetric Neuraminidase Assay Kit *Blue Fluorescence* AAT Bioquest 1 kit 280€
ASK
Pub
128-10165-1 Rabbit Anti-SARS Virus Nucleocapsid Protein Antibodies Ray Biotech 100 766 128-10165-1 Rabbit Anti-SARS Virus Nucleocapsid Protein Antibodies Ray Biotech 100 766€
ASK
Pub
128-10166-1 Mouse Anti-SARS-Associated Coronavirus Nucleocapsid protein Ray Biotech 100 1146 128-10166-1 Mouse Anti-SARS-Associated Coronavirus Nucleocapsid protein Ray Biotech 100 1146€
ASK
Pub
128-10168-1 Rabbit Anti-SARS-Associated Coronavirus Spike Protein Ray Biotech 100 1297 128-10168-1 Rabbit Anti-SARS-Associated Coronavirus Spike Protein Ray Biotech 100 1297€
ASK
Pub
129-10603 Rabbit Anti-SARS-Associated Coronavirus Membrane Protein, C-terminus Ray Biotech 100 528 129-10603 Rabbit Anti-SARS-Associated Coronavirus Membrane Protein, C-terminus Ray Biotech 100 528€
ASK
Pub
129-10688 Rabbit Anti-WNV Core Protein, C-terminus Ray Biotech 100 528 129-10688 Rabbit Anti-WNV Core Protein, C-terminus Ray Biotech 100 528€
ASK
Pub
13502 Amplite™ Fluorimetric Caspase 3 7 Assay Kit *Blue Fluorescence* AAT Bioquest 1 kit 130 13502 Amplite™ Fluorimetric Caspase 3 7 Assay Kit *Blue Fluorescence* AAT Bioquest 1 kit 130€
ASK
Pub
13504 Amplite™ Fluorimetric Caspase 3 7 Assay Kit *Red Fluorescence* AAT Bioquest 100 tests 319 13504 Amplite™ Fluorimetric Caspase 3 7 Assay Kit *Red Fluorescence* AAT Bioquest 100 tests 319€
ASK
Pub
165-21141 Parathyroid Hormone Related Protein, Human (PTHrP), recombinant B-Bridge 50 ug 758.478 165-21141 Parathyroid Hormone Related Protein, Human (PTHrP), recombinant B-Bridge 50 ug 758.478€
ASK
Pub
165-21141 Parathyroid Hormone Related Protein, Human (PTHrP), recombinant Parathyroid Hormone Related Protein, Human (PTHrP), recombinant B-Bridge 50 ug 520.8 165-21141 Parathyroid Hormone Related Protein, Human (PTHrP), recombinant Parathyroid Hormone Related Protein, Human (PTHrP), recombinant B-Bridge 50 ug 520.8€
ASK
Pub
18-272-195411 S100 alpha - Rabbit polyclonal to S100 alpha; S100 calcium-binding protein A1; S-100 protein alpha subunit; S-100 protein alpha chain Polyclonal GenWay 0.05 mg 448 18-272-195411 S100 alpha - Rabbit polyclonal to S100 alpha; S100 calcium-binding protein A1; S-100 protein alpha subunit; S-100 protein alpha chain Polyclonal GenWay 0.05 mg 448€
ASK
Pub
2 Fluorescein, disodium salt *Fluorescence reference standard* AAT Bioquest 100 mg 108 2 Fluorescein, disodium salt *Fluorescence reference standard* AAT Bioquest 100 mg 108€
ASK
Pub
200-10 Proteins: Mouse CD40 Ligand Shenandoah Biotechnology, Inc. 100ug 416 200-10 Proteins: Mouse CD40 Ligand Shenandoah Biotechnology, Inc. 100ug 416€ Pub
20100 Cell Meter™ Live Cell Caspase 3 7 Binding Assay Kit *Green Fluorescence* AAT Bioquest 100 tests 212 20100 Cell Meter™ Live Cell Caspase 3 7 Binding Assay Kit *Green Fluorescence* AAT Bioquest 100 tests 212€
ASK
Pub
20101 Cell Meter™ Live Cell Caspase 3 7 Binding Assay Kit *Red Fluorescence* AAT Bioquest 100 tests 212 20101 Cell Meter™ Live Cell Caspase 3 7 Binding Assay Kit *Red Fluorescence* AAT Bioquest 100 tests 212€ Pub
21121 JAK2 (Ab 1007) Antibody Host Species Rabbit polyclonal SignalWay Antibody S.A.B 50 ug 143 21121 JAK2 (Ab 1007) Antibody Host Species Rabbit polyclonal SignalWay Antibody S.A.B 50 ug 143€
ASK
Pub
21225 S6 Ribosomal Protein(Ab 235) Antibody Host Species Rabbit polyclonal SignalWay Antibody S.A.B 50 ug 143 21225 S6 Ribosomal Protein(Ab 235) Antibody Host Species Rabbit polyclonal SignalWay Antibody S.A.B 50 ug 143€
ASK
Pub
21409 Prospero homeobox protein 1 Antibody Host Species Rabbit polyclonal SignalWay Antibody S.A.B 50 ug 143 21409 Prospero homeobox protein 1 Antibody Host Species Rabbit polyclonal SignalWay Antibody S.A.B 50 ug 143€
ASK
Pub
21412 Coiled coil domain containing protein 106 antibody Host Species Rabbit polyclonal SignalWay Antibody S.A.B 50 ug 143 21412 Coiled coil domain containing protein 106 antibody Host Species Rabbit polyclonal SignalWay Antibody S.A.B 50 ug 143€
ASK
Pub
21413 Zinc finger CCHC domain containing protein 10 antibody Host Species Rabbit polyclonal SignalWay Antibody S.A.B 50 ug 143 21413 Zinc finger CCHC domain containing protein 10 antibody Host Species Rabbit polyclonal SignalWay Antibody S.A.B 50 ug 143€
ASK
Pub
21548 Met (Ab 1003) Antibody Host Species Rabbit polyclonal SignalWay Antibody S.A.B 50 ug 143 21548 Met (Ab 1003) Antibody Host Species Rabbit polyclonal SignalWay Antibody S.A.B 50 ug 143€
ASK
Pub
21611 PhosphoWorks™ Fluorimetric Pyrophosphate Assay Kit *Blue Fluorescence* AAT Bioquest 1 kit 202 21611 PhosphoWorks™ Fluorimetric Pyrophosphate Assay Kit *Blue Fluorescence* AAT Bioquest 1 kit 202€
ASK
Pub
22008 Cartilage-associated protein antibody Source Rabbit Polyconal Ab Species Human Application WB IF SignalWay Antibody S.A.B 100ul 329 22008 Cartilage-associated protein antibody Source Rabbit Polyconal Ab Species Human Application WB IF SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22023 NHP2-like protein 1 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC IF SignalWay Antibody S.A.B 100ul 329 22023 NHP2-like protein 1 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC IF SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22033 ribosome binding protein 1 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC IF SignalWay Antibody S.A.B 100ul 329 22033 ribosome binding protein 1 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC IF SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22035 ribosome binding protein 1 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC IF SignalWay Antibody S.A.B 100ul 329 22035 ribosome binding protein 1 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC IF SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22116 ribosomal protein S10 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC SignalWay Antibody S.A.B 100ul 329 22116 ribosomal protein S10 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22159 translocation associated membrane protein 1 antibody Source Rabbit Polyconal Ab Species Human Application WB IF SignalWay Antibody S.A.B 100ul 329 22159 translocation associated membrane protein 1 antibody Source Rabbit Polyconal Ab Species Human Application WB IF SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22162 SEC13 protein isoform 1 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC SignalWay Antibody S.A.B 100ul 329 22162 SEC13 protein isoform 1 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22248 cell cycle progression 2 protein isoform 2 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC IF SignalWay Antibody S.A.B 100ul 329 22248 cell cycle progression 2 protein isoform 2 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC IF SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22250 UGT1A9 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC SignalWay Antibody S.A.B 100ul 329 22250 UGT1A9 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22252 CytoTell™ Blue AAT Bioquest 1000 Tests 163 22252 CytoTell™ Blue AAT Bioquest 1000 Tests 163€
ASK
Pub
22263 calcium binding protein P22 antibody Source Rabbit Polyconal Ab Species Human Application WB IF SignalWay Antibody S.A.B 100ul 329 22263 calcium binding protein P22 antibody Source Rabbit Polyconal Ab Species Human Application WB IF SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22281 Bcl-2-like protein 12 antibody Source Rabbit Polyconal Ab Species Human Application WB IF SignalWay Antibody S.A.B 100ul 329 22281 Bcl-2-like protein 12 antibody Source Rabbit Polyconal Ab Species Human Application WB IF SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22294 Breast cancer membrane protein 11 precursor antibody Source Rabbit Polyconal Ab Species Human Application WB IHC IF SignalWay Antibody S.A.B 100ul 329 22294 Breast cancer membrane protein 11 precursor antibody Source Rabbit Polyconal Ab Species Human Application WB IHC IF SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22402 Myotubularin related protein 2 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC SignalWay Antibody S.A.B 100ul 329 22402 Myotubularin related protein 2 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22411 TOM1-like protein 2 antibody Source Rabbit Polyconal Ab Species Human Application WB SignalWay Antibody S.A.B 100ul 329 22411 TOM1-like protein 2 antibody Source Rabbit Polyconal Ab Species Human Application WB SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22439 G protein-coupled receptor family C group 6 member A precursor antibody Source Rabbit Polyconal Ab Species Human Application WB SignalWay Antibody S.A.B 100ul 329 22439 G protein-coupled receptor family C group 6 member A precursor antibody Source Rabbit Polyconal Ab Species Human Application WB SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22456 F-box only protein 2 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC SignalWay Antibody S.A.B 100ul 329 22456 F-box only protein 2 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22468 SH3 domain-binding protein 1 antibody Source Rabbit Polyconal Ab Species Human Application WB IF SignalWay Antibody S.A.B 100ul 329 22468 SH3 domain-binding protein 1 antibody Source Rabbit Polyconal Ab Species Human Application WB IF SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22495 ubiquinol-cytochrome c reductase core protein I precursor antibody Source Rabbit Polyconal Ab Species Human Application WB SignalWay Antibody S.A.B 100ul 329 22495 ubiquinol-cytochrome c reductase core protein I precursor antibody Source Rabbit Polyconal Ab Species Human Application WB SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22500 Cell Explorer™ Fixed Cell Labeling Kit *Blue Fluorescence with 405 nm Excitation* AAT Bioquest 1 kit 172 22500 Cell Explorer™ Fixed Cell Labeling Kit *Blue Fluorescence with 405 nm Excitation* AAT Bioquest 1 kit 172€
ASK
Pub
22510 steroidogenic acute regulatory protein isoform 1 antibody Source Rabbit Polyconal Ab Species Human Application WB SignalWay Antibody S.A.B 100ul 329 22510 steroidogenic acute regulatory protein isoform 1 antibody Source Rabbit Polyconal Ab Species Human Application WB SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22528 zinc finger protein 574 antibody Source Rabbit Polyconal Ab Species Human Application WB SignalWay Antibody S.A.B 100ul 329 22528 zinc finger protein 574 antibody Source Rabbit Polyconal Ab Species Human Application WB SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22544 ribosomal protein S3a antibody Source Rabbit Polyconal Ab Species Human Application WB IF SignalWay Antibody S.A.B 100ul 329 22544 ribosomal protein S3a antibody Source Rabbit Polyconal Ab Species Human Application WB IF SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22600 Cell Explorer™ Fixed Cell Labeling Kit *Blue Fluorescence* AAT Bioquest 1 kit 164 22600 Cell Explorer™ Fixed Cell Labeling Kit *Blue Fluorescence* AAT Bioquest 1 kit 164€
ASK
Pub
22606 Cell Explorer™ Live Cell Labeling Kit *Blue Fluorescence* AAT Bioquest 1 kit 202 22606 Cell Explorer™ Live Cell Labeling Kit *Blue Fluorescence* AAT Bioquest 1 kit 202€
ASK
Pub
22614 Cell Explorer™ Live Cell Labeling Kit *Blue Fluorescence with 405 nm Excitation* AAT Bioquest 1 kit 202 22614 Cell Explorer™ Live Cell Labeling Kit *Blue Fluorescence with 405 nm Excitation* AAT Bioquest 1 kit 202€
ASK
Pub
22616 Homeobox-containing protein 1 antibody Source Rabbit Polyconal Ab Species human Application WB IHC IF SignalWay Antibody S.A.B 100ul 329 22616 Homeobox-containing protein 1 antibody Source Rabbit Polyconal Ab Species human Application WB IHC IF SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22620 Cell Explorer™ Cell Tracking Kit *Blue Fluorescence* AAT Bioquest 1 kit 212 22620 Cell Explorer™ Cell Tracking Kit *Blue Fluorescence* AAT Bioquest 1 kit 212€
ASK
Pub
22660 Cell Navigator™ F Actin Labeling Kit *Blue Fluorescence* AAT Bioquest 1 kit 202 22660 Cell Navigator™ F Actin Labeling Kit *Blue Fluorescence* AAT Bioquest 1 kit 202€
ASK
Pub
22669 Guanylate-binding protein 3 antibody Source Rabbit Polyconal Ab Species human Application WB IHC IF SignalWay Antibody S.A.B 100ul 329 22669 Guanylate-binding protein 3 antibody Source Rabbit Polyconal Ab Species human Application WB IHC IF SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22673 amyloid beta precursor protein-binding family B member 3 isoform a antibody Source Rabbit Polyconal Ab Species Human Application WB SignalWay Antibody S.A.B 100ul 329 22673 amyloid beta precursor protein-binding family B member 3 isoform a antibody Source Rabbit Polyconal Ab Species Human Application WB SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22731 Docking protein 3 antibody Source Rabbit Polyconal Ab Species Human Application WB SignalWay Antibody S.A.B 100ul 329 22731 Docking protein 3 antibody Source Rabbit Polyconal Ab Species Human Application WB SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22784 Cell Meter™ Cell Viability Assay Kit *Blue Fluorescence with 405 nm Excitation* AAT Bioquest 1 kit 202 22784 Cell Meter™ Cell Viability Assay Kit *Blue Fluorescence with 405 nm Excitation* AAT Bioquest 1 kit 202€
ASK
Pub
22785 Cell Meter™ Cell Viability Assay Kit *Blue Fluorescence* AAT Bioquest 1 kit 163 22785 Cell Meter™ Cell Viability Assay Kit *Blue Fluorescence* AAT Bioquest 1 kit 163€
ASK
Pub
22789 Tubby-related protein 1 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC IF SignalWay Antibody S.A.B 100ul 329 22789 Tubby-related protein 1 antibody Source Rabbit Polyconal Ab Species Human Application WB IHC IF SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
22790 Cell Meter™ Phosphatidylserine Apoptosis Assay Kit *Blue Fluorescence* AAT Bioquest 1 kit 220 22790 Cell Meter™ Phosphatidylserine Apoptosis Assay Kit *Blue Fluorescence* AAT Bioquest 1 kit 220€
ASK
Pub
22794 Cell Meter™ Phosphatidylserine Apoptosis Assay Kit *Blue Fluorescence Optimized for Microplate Readers* AAT Bioquest 1 kit 215 22794 Cell Meter™ Phosphatidylserine Apoptosis Assay Kit *Blue Fluorescence Optimized for Microplate Readers* AAT Bioquest 1 kit 215€
ASK
Pub
22795 Cell Meter™ Caspase 3 7 Activity Apoptosis Assay Kit * Blue Fluorescence* AAT Bioquest 1 kit 130 22795 Cell Meter™ Caspase 3 7 Activity Apoptosis Assay Kit * Blue Fluorescence* AAT Bioquest 1 kit 130€
ASK
Pub
22797 Cell Meter™ Caspase 3 7 Activity Apoptosis Assay Kit *Red Fluorescence* AAT Bioquest 100 Tests 280 22797 Cell Meter™ Caspase 3 7 Activity Apoptosis Assay Kit *Red Fluorescence* AAT Bioquest 100 Tests 280€
ASK
Pub
228-10006-2 Native Human AMBP Proteins Ray Biotech 100 205 228-10006-2 Native Human AMBP Proteins Ray Biotech 100 205€ Pub
228-10018-2 Native Human SERPINA3 Proteins Ray Biotech 100 205 228-10018-2 Native Human SERPINA3 Proteins Ray Biotech 100 205€
ASK
Pub
228-10030-3 Recombinant M. tuberculosis Ag85B Proteins Ray Biotech 100 1031 228-10030-3 Recombinant M. tuberculosis Ag85B Proteins Ray Biotech 100 1031€ Pub
228-10051-2 Recombinant Human Angiostatin K1-3 Proteins Ray Biotech 100 205 228-10051-2 Recombinant Human Angiostatin K1-3 Proteins Ray Biotech 100 205€ Pub
228-10057-3 Recombinant Human ANXA1 Proteins Ray Biotech 100 1658 228-10057-3 Recombinant Human ANXA1 Proteins Ray Biotech 100 1658€
ASK
Pub
228-10072-3 Recombinant Bovine Aprotinin Proteins Ray Biotech 100mg 667 228-10072-3 Recombinant Bovine Aprotinin Proteins Ray Biotech 100mg 667€
ASK
Pub
228-10079-3 Recombinant Yeast ATP sulfurylase Proteins Ray Biotech 100IU 535 228-10079-3 Recombinant Yeast ATP sulfurylase Proteins Ray Biotech 100IU 535€
ASK
Pub
228-10083-3 Native Chicken Avidin Proteins Ray Biotech 100mg 1031 228-10083-3 Native Chicken Avidin Proteins Ray Biotech 100mg 1031€
ASK
Pub
228-10084-1 Native Human APOH B2GPI Proteins Ray Biotech 100 147 228-10084-1 Native Human APOH B2GPI Proteins Ray Biotech 100 147€
ASK
Pub
228-10141-1 Recombinant B. burgdorfer p41 (Lyme) Proteins Ray Biotech 100 292 228-10141-1 Recombinant B. burgdorfer p41 (Lyme) Proteins Ray Biotech 100 292€ Pub
228-10141-3 Recombinant B. burgdorfer p41 (Lyme) Proteins Ray Biotech 1000 1244 228-10141-3 Recombinant B. burgdorfer p41 (Lyme) Proteins Ray Biotech 1000 1244€ Pub
228-10145-3 Native Bovine BSA Proteins Ray Biotech 100g 292 228-10145-3 Native Bovine BSA Proteins Ray Biotech 100g 292€ Pub
228-10155-3 Recombinant Rat CaBP28K Proteins Ray Biotech 100 2261 228-10155-3 Recombinant Rat CaBP28K Proteins Ray Biotech 100 2261€
ASK
Pub
228-10157-3 Recombinant Rat CaBP9K Proteins Ray Biotech 100 2030 228-10157-3 Recombinant Rat CaBP9K Proteins Ray Biotech 100 2030€
ASK
Pub
228-10164-3 Recombinant Influenza HA (A Caledonia 20 99) Proteins Ray Biotech 100 1658 228-10164-3 Recombinant Influenza HA (A Caledonia 20 99) Proteins Ray Biotech 100 1658€ Pub
228-10225-3 Recombinant T. cruzi Ag. Proteins Ray Biotech 100 997 228-10225-3 Recombinant T. cruzi Ag. Proteins Ray Biotech 100 997€
ASK
Pub
228-10226-1 Recombinant C. trachomatis W2 Proteins Ray Biotech 100 240 228-10226-1 Recombinant C. trachomatis W2 Proteins Ray Biotech 100 240€
ASK
Pub
228-10226-3 Recombinant C. trachomatis W2 Proteins Ray Biotech 1000 1244 228-10226-3 Recombinant C. trachomatis W2 Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10232-1 Recombinant C. trachomatis HSP70 (aa 549-660) Proteins Ray Biotech 100 240 228-10232-1 Recombinant C. trachomatis HSP70 (aa 549-660) Proteins Ray Biotech 100 240€
ASK
Pub
228-10232-3 Recombinant C. trachomatis HSP70 (aa 549-660) Proteins Ray Biotech 1000 1244 228-10232-3 Recombinant C. trachomatis HSP70 (aa 549-660) Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10233-1 Recombinant C. trachomatis HSP70 (aa 462-503) Proteins Ray Biotech 100 240 228-10233-1 Recombinant C. trachomatis HSP70 (aa 462-503) Proteins Ray Biotech 100 240€
ASK
Pub
228-10233-3 Recombinant C. trachomatis HSP70 (aa 462-503) Proteins Ray Biotech 1000 1244 228-10233-3 Recombinant C. trachomatis HSP70 (aa 462-503) Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10234-1 Recombinant C. trachomatis PGP-3D Proteins Ray Biotech 100 147 228-10234-1 Recombinant C. trachomatis PGP-3D Proteins Ray Biotech 100 147€ Pub
228-10234-3 Recombinant C. trachomatis PGP-3D Proteins Ray Biotech 1000 1244 228-10234-3 Recombinant C. trachomatis PGP-3D Proteins Ray Biotech 1000 1244€ Pub
228-10253-1 Recombinant CMV gB Proteins Ray Biotech 100 240 228-10253-1 Recombinant CMV gB Proteins Ray Biotech 100 240€ Pub
228-10255-1 Recombinant CMV pp150 Proteins Ray Biotech 100 240 228-10255-1 Recombinant CMV pp150 Proteins Ray Biotech 100 240€ Pub
228-10255-3 Recombinant CMV pp150 Proteins Ray Biotech 1000 1031 228-10255-3 Recombinant CMV pp150 Proteins Ray Biotech 1000 1031€ Pub
228-10256-1 Recombinant CMV pp28 Proteins Ray Biotech 100 240 228-10256-1 Recombinant CMV pp28 Proteins Ray Biotech 100 240€ Pub
228-10256-3 Recombinant CMV pp28 Proteins Ray Biotech 1000 1031 228-10256-3 Recombinant CMV pp28 Proteins Ray Biotech 1000 1031€ Pub
228-10257-1 Recombinant CMV pp38 Proteins Ray Biotech 100 240 228-10257-1 Recombinant CMV pp38 Proteins Ray Biotech 100 240€ Pub
228-10257-3 Recombinant CMV pp38 Proteins Ray Biotech 1000 1031 228-10257-3 Recombinant CMV pp38 Proteins Ray Biotech 1000 1031€ Pub
228-10258-1 Recombinant CMV pp52 Proteins Ray Biotech 100 240 228-10258-1 Recombinant CMV pp52 Proteins Ray Biotech 100 240€ Pub
228-10258-3 Recombinant CMV pp52 Proteins Ray Biotech 1000 1031 228-10258-3 Recombinant CMV pp52 Proteins Ray Biotech 1000 1031€ Pub
228-10259-1 Recombinant CMV pp65 Proteins Ray Biotech 100 147 228-10259-1 Recombinant CMV pp65 Proteins Ray Biotech 100 147€ Pub
228-10259-3 Recombinant CMV pp65 Proteins Ray Biotech 1000 1031 228-10259-3 Recombinant CMV pp65 Proteins Ray Biotech 1000 1031€ Pub
228-10280-2 Recombinant Human CRYAA Proteins Ray Biotech 100 205 228-10280-2 Recombinant Human CRYAA Proteins Ray Biotech 100 205€
ASK
Pub
228-10281-2 Recombinant Human CRYAB Proteins Ray Biotech 100 205 228-10281-2 Recombinant Human CRYAB Proteins Ray Biotech 100 205€
ASK
Pub
228-10310-1 Recombinant Dengue Virus Envelope Proteins Ray Biotech 100 240 228-10310-1 Recombinant Dengue Virus Envelope Proteins Ray Biotech 100 240€ Pub
228-10310-3 Recombinant Dengue Virus Envelope Proteins Ray Biotech 1000 1244 228-10310-3 Recombinant Dengue Virus Envelope Proteins Ray Biotech 1000 1244€ Pub
228-10311-1 Recombinant Dengue Virus Envelope P1 Proteins Ray Biotech 100 240 228-10311-1 Recombinant Dengue Virus Envelope P1 Proteins Ray Biotech 100 240€ Pub
228-10311-3 Recombinant Dengue Virus Envelope Protein-1 Ray Biotech 1000 1876 228-10311-3 Recombinant Dengue Virus Envelope Protein-1 Ray Biotech 1000 1876€ Pub
228-10312-1 Recombinant Dengue Virus Envelope P3 Proteins Ray Biotech 100 240 228-10312-1 Recombinant Dengue Virus Envelope P3 Proteins Ray Biotech 100 240€ Pub
228-10312-3 Recombinant Dengue Virus Envelope P3 Proteins Ray Biotech 1000 1244 228-10312-3 Recombinant Dengue Virus Envelope P3 Proteins Ray Biotech 1000 1244€ Pub
228-10313-1 Recombinant Dengue Virus Envelope P4 Proteins Ray Biotech 100 240 228-10313-1 Recombinant Dengue Virus Envelope P4 Proteins Ray Biotech 100 240€ Pub
228-10313-3 Recombinant Dengue Virus Envelope P4 Proteins Ray Biotech 1000 1244 228-10313-3 Recombinant Dengue Virus Envelope P4 Proteins Ray Biotech 1000 1244€ Pub
228-10314-1 Recombinant Dengue Virus NS1 Proteins Ray Biotech 100 240 228-10314-1 Recombinant Dengue Virus NS1 Proteins Ray Biotech 100 240€ Pub
228-10314-3 Recombinant Dengue Virus NS1 Proteins Ray Biotech 1000 1244 228-10314-3 Recombinant Dengue Virus NS1 Proteins Ray Biotech 1000 1244€ Pub
228-10318-1 Recombinant Dengue Virus Antigen Proteins Ray Biotech 100 240 228-10318-1 Recombinant Dengue Virus Antigen Proteins Ray Biotech 100 240€
ASK
Pub
228-10318-3 Recombinant Dengue Virus Proteins Ray Biotech 1000 1244 228-10318-3 Recombinant Dengue Virus Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10319-1 Recombinant DERL1 Proteins Ray Biotech 100 240 228-10319-1 Recombinant DERL1 Proteins Ray Biotech 100 240€
ASK
Pub
228-10319-3 Recombinant DERL1 Proteins Ray Biotech 1000 1031 228-10319-3 Recombinant DERL1 Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10327-2 Recombinant E. coli HSP40 DnaJ Proteins Ray Biotech 100 205 228-10327-2 Recombinant E. coli HSP40 DnaJ Proteins Ray Biotech 100 205€ Pub
228-10329-3 Recombinant M. tuberculosis HSP70 DnaK Proteins Ray Biotech 100 1312 228-10329-3 Recombinant M. tuberculosis HSP70 DnaK Proteins Ray Biotech 100 1312€
ASK
Pub
228-10333-2 Recombinant E. coli HSP70 DnaK LCS Proteins Ray Biotech 100 205 228-10333-2 Recombinant E. coli HSP70 DnaK LCS Proteins Ray Biotech 100 205€
ASK
Pub
228-10334-2 Recombinant E. coli HSP70 DnaK SBD Proteins Ray Biotech 100 205 228-10334-2 Recombinant E. coli HSP70 DnaK SBD Proteins Ray Biotech 100 205€
ASK
Pub
228-10335-2 Recombinant E. coli HSP70 DnaK SBD Proteins Ray Biotech 100 205 228-10335-2 Recombinant E. coli HSP70 DnaK SBD Proteins Ray Biotech 100 205€
ASK
Pub
228-10336-2 Native Bacterial DNase Proteins Ray Biotech 100mg 205 228-10336-2 Native Bacterial DNase Proteins Ray Biotech 100mg 205€
ASK
Pub
228-10350-1 Recombinant EBV EA Proteins Ray Biotech 100 240 228-10350-1 Recombinant EBV EA Proteins Ray Biotech 100 240€
ASK
Pub
228-10350-3 Recombinant EBV EA Proteins Ray Biotech 1000 1031 228-10350-3 Recombinant EBV EA Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10351-1 Recombinant EBV EBNA1 Proteins Ray Biotech 100 353 228-10351-1 Recombinant EBV EBNA1 Proteins Ray Biotech 100 353€ Pub
228-10351-3 Recombinant EBV EBNA1 Proteins Ray Biotech 1000 1031 228-10351-3 Recombinant EBV EBNA1 Proteins Ray Biotech 1000 1031€ Pub
228-10352-1 Recombinant EBV EBNA1 [+His] Proteins Ray Biotech 100 240 228-10352-1 Recombinant EBV EBNA1 [+His] Proteins Ray Biotech 100 240€
ASK
Pub
228-10352-3 Recombinant EBV EBNA1 [+His] Proteins Ray Biotech 1000 1452 228-10352-3 Recombinant EBV EBNA1 [+His] Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10353-1 Recombinant EBV p18 Proteins Ray Biotech 100 240 228-10353-1 Recombinant EBV p18 Proteins Ray Biotech 100 240€
ASK
Pub
228-10353-3 Recombinant EBV Mosaic Proteins Ray Biotech 1000 1244 228-10353-3 Recombinant EBV Mosaic Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10354-1 Recombinant EBV p18 Proteins Ray Biotech 100 353 228-10354-1 Recombinant EBV p18 Proteins Ray Biotech 100 353€
ASK
Pub
228-10354-3 Recombinant EBV p18 Proteins Ray Biotech 1000 1031 228-10354-3 Recombinant EBV p18 Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10355-1 Recombinant EBV p18 [GST-fusion] Proteins Ray Biotech 100 240 228-10355-1 Recombinant EBV p18 [GST-fusion] Proteins Ray Biotech 100 240€
ASK
Pub
228-10355-3 Recombinant EBV p18 [GST-fusion] Proteins Ray Biotech 1000 1452 228-10355-3 Recombinant EBV p18 [GST-fusion] Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10356-1 Recombinant EBV p23 Proteins Ray Biotech 100 353 228-10356-1 Recombinant EBV p23 Proteins Ray Biotech 100 353€
ASK
Pub
228-10356-3 Recombinant EBV p23 Proteins Ray Biotech 1000 1031 228-10356-3 Recombinant EBV p23 Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10357-1 Recombinant EBV p23 [+His] Proteins Ray Biotech 100 147 228-10357-1 Recombinant EBV p23 [+His] Proteins Ray Biotech 100 147€
ASK
Pub
228-10357-3 Recombinant EBV p23 [+His] Proteins Ray Biotech 1000 1452 228-10357-3 Recombinant EBV p23 [+His] Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10358-3 Native Bovine ECGS Proteins Ray Biotech 100mg 733 228-10358-3 Native Bovine ECGS Proteins Ray Biotech 100mg 733€ Pub
228-10360-1 Recombinant Human EGF Proteins Ray Biotech 100 147 228-10360-1 Recombinant Human EGF Proteins Ray Biotech 100 147€ Pub
228-10362-1 Recombinant Mouse EGF Proteins Ray Biotech 100 205 228-10362-1 Recombinant Mouse EGF Proteins Ray Biotech 100 205€
ASK
Pub
228-10364-2 Recombinant Rat EGF Proteins Ray Biotech 100 205 228-10364-2 Recombinant Rat EGF Proteins Ray Biotech 100 205€
ASK
Pub
228-10365-2 Recombinant Human EGF (Leu 21) Proteins Ray Biotech 100 205 228-10365-2 Recombinant Human EGF (Leu 21) Proteins Ray Biotech 100 205€
ASK
Pub
228-10366-1 Recombinant Human EGF Proteins Ray Biotech 100 147 228-10366-1 Recombinant Human EGF Proteins Ray Biotech 100 147€
ASK
Pub
228-10367-3 Recombinant Human EGFR ErbB1 Proteins Ray Biotech 100 733 228-10367-3 Recombinant Human EGFR ErbB1 Proteins Ray Biotech 100 733€ Pub
228-10376-1 Recombinant Tick-Borne Encephalitis gE (aa 296-414) Proteins Ray Biotech 100 240 228-10376-1 Recombinant Tick-Borne Encephalitis gE (aa 296-414) Proteins Ray Biotech 100 240€
ASK
Pub
228-10376-3 Recombinant Tick-Borne Encephalitis gE (aa 296-414) Proteins Ray Biotech 1000 1031 228-10376-3 Recombinant Tick-Borne Encephalitis gE (aa 296-414) Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10378-1 Recombinant Tick-Borne Encephalitis Core Proteins Ray Biotech 100 240 228-10378-1 Recombinant Tick-Borne Encephalitis Core Proteins Ray Biotech 100 240€
ASK
Pub
228-10378-3 Recombinant Tick-Borne Encephalitis Core Proteins Ray Biotech 1000 1031 228-10378-3 Recombinant Tick-Borne Encephalitis Core Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10379-1 Recombinant Tick-Borne Encephalitis gE Proteins Ray Biotech 100 240 228-10379-1 Recombinant Tick-Borne Encephalitis gE Proteins Ray Biotech 100 240€
ASK
Pub
228-10379-3 Recombinant Tick-Borne Encephalitis gE Proteins Ray Biotech 1000 1031 228-10379-3 Recombinant Tick-Borne Encephalitis gE Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10380-1 Recombinant Tick-Borne Encephalitis (aa 50-250) Proteins Ray Biotech 100 240 228-10380-1 Recombinant Tick-Borne Encephalitis (aa 50-250) Proteins Ray Biotech 100 240€
ASK
Pub
228-10380-3 Recombinant Tick-Borne Encephalitis (aa 50-250) Proteins Ray Biotech 1000 1031 228-10380-3 Recombinant Tick-Borne Encephalitis (aa 50-250) Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10381-1 Recombinant Japanese Encephalitis Proteins Ray Biotech 100 240 228-10381-1 Recombinant Japanese Encephalitis Proteins Ray Biotech 100 240€
ASK
Pub
228-10385-1 Recombinant Tick-Borne Encephalitis PreM Proteins Ray Biotech 100 292 228-10385-1 Recombinant Tick-Borne Encephalitis PreM Proteins Ray Biotech 100 292€
ASK
Pub
228-10388-3 Recombinant Human Endoglin Proteins Ray Biotech 100 1031 228-10388-3 Recombinant Human Endoglin Proteins Ray Biotech 100 1031€
ASK
Pub
228-10394-2 Recombinant Bovine Enterokinase Proteins Ray Biotech 100IU 452 228-10394-2 Recombinant Bovine Enterokinase Proteins Ray Biotech 100IU 452€ Pub
228-10395-2 Recombinant Human Enterokinase Proteins Ray Biotech 100IU 452 228-10395-2 Recombinant Human Enterokinase Proteins Ray Biotech 100IU 452€ Pub
228-10407-3 Eptifibatide Proteins Ray Biotech 100mg 485 228-10407-3 Eptifibatide Proteins Ray Biotech 100mg 485€
ASK
Pub
228-10414-3 Recombinant Human ERK2 MAPK1 Proteins Ray Biotech 100 1137 228-10414-3 Recombinant Human ERK2 MAPK1 Proteins Ray Biotech 100 1137€ Pub
228-10415-3 Recombinant Human ERK2 MAPK1 Proteins Ray Biotech 100 1137 228-10415-3 Recombinant Human ERK2 MAPK1 Proteins Ray Biotech 100 1137€ Pub
228-10434-1 Native Human Factor IX Proteins Ray Biotech 100IU 205 228-10434-1 Native Human Factor IX Proteins Ray Biotech 100IU 205€ Pub
228-10434-3 Native Human Factor IX Proteins Ray Biotech 1000IU 2673 228-10434-3 Native Human Factor IX Proteins Ray Biotech 1000IU 2673€ Pub
228-10436-3 Recombinant Human Factor VIII Proteins Ray Biotech 1000IU 0 228-10436-3 Recombinant Human Factor VIII Proteins Ray Biotech 1000IU 0€ Pub
228-10445-3 Native Bovine FGF1 FGF acidic Proteins Ray Biotech 100 1906 228-10445-3 Native Bovine FGF1 FGF acidic Proteins Ray Biotech 100 1906€
ASK
Pub
228-10462-3 Recombinant Human FGF23 Proteins Ray Biotech 100 1244 228-10462-3 Recombinant Human FGF23 Proteins Ray Biotech 100 1244€ Pub
228-10476-3 Recombinant Human FKBP1A Proteins Ray Biotech 100 485 228-10476-3 Recombinant Human FKBP1A Proteins Ray Biotech 100 485€
ASK
Pub
228-10481-3 Recombinant Human FLT1 VEGF R1 Proteins Ray Biotech 100 1031 228-10481-3 Recombinant Human FLT1 VEGF R1 Proteins Ray Biotech 100 1031€ Pub
228-10482-3 Recombinant Human FLT1 VEGF R1 D3 Proteins Ray Biotech 100 1031 228-10482-3 Recombinant Human FLT1 VEGF R1 D3 Proteins Ray Biotech 100 1031€ Pub
228-10484-3 Recombinant Human FLT1 VEGF R1 D4 Proteins Ray Biotech 100 1031 228-10484-3 Recombinant Human FLT1 VEGF R1 D4 Proteins Ray Biotech 100 1031€ Pub
228-10485-3 Recombinant Human FLT1 VEGF R1 D5 Proteins Ray Biotech 100 1031 228-10485-3 Recombinant Human FLT1 VEGF R1 D5 Proteins Ray Biotech 100 1031€ Pub
228-10489-3 Recombinant Human Flt3 Ligand Proteins Ray Biotech 100 1137 228-10489-3 Recombinant Human Flt3 Ligand Proteins Ray Biotech 100 1137€
ASK
Pub
228-10497-1 Native Human FSH Proteins Ray Biotech 100IU 147 228-10497-1 Native Human FSH Proteins Ray Biotech 100IU 147€ Pub
228-10528-2 Recombinant Bovine GH Proteins Ray Biotech 100 205 228-10528-2 Recombinant Bovine GH Proteins Ray Biotech 100 205€ Pub
228-10529-2 Recombinant Chicken GH Proteins Ray Biotech 100 205 228-10529-2 Recombinant Chicken GH Proteins Ray Biotech 100 205€
ASK
Pub
228-10531-1 Recombinant Rat GH Proteins Ray Biotech 100 147 228-10531-1 Recombinant Rat GH Proteins Ray Biotech 100 147€
ASK
Pub
228-10532-1 Recombinant Human GH Proteins Ray Biotech 100 205 228-10532-1 Recombinant Human GH Proteins Ray Biotech 100 205€ Pub
228-10533-1 Recombinant Mouse GH Proteins Ray Biotech 100 147 228-10533-1 Recombinant Mouse GH Proteins Ray Biotech 100 147€
ASK
Pub
228-10534-2 Recombinant Sheep GH Proteins Ray Biotech 100 205 228-10534-2 Recombinant Sheep GH Proteins Ray Biotech 100 205€ Pub
228-10535-1 Recombinant Porcine GH Proteins Ray Biotech 100 147 228-10535-1 Recombinant Porcine GH Proteins Ray Biotech 100 147€
ASK
Pub
228-10537-1 Recombinant Seabream GH Proteins Ray Biotech 100 147 228-10537-1 Recombinant Seabream GH Proteins Ray Biotech 100 147€
ASK
Pub
228-10539-2 Recombinant Chicken GH Antagonist Proteins Ray Biotech 100 205 228-10539-2 Recombinant Chicken GH Antagonist Proteins Ray Biotech 100 205€
ASK
Pub
228-10540-2 Recombinant Sheep GH Antagonist Proteins Ray Biotech 100 205 228-10540-2 Recombinant Sheep GH Antagonist Proteins Ray Biotech 100 205€
ASK
Pub
228-10541-2 Recombinant Sheep GH Placental Proteins Ray Biotech 100 205 228-10541-2 Recombinant Sheep GH Placental Proteins Ray Biotech 100 205€
ASK
Pub
228-10554-3 Recombinant Porcine GM-CSF CSF2 Proteins Ray Biotech 100 1312 228-10554-3 Recombinant Porcine GM-CSF CSF2 Proteins Ray Biotech 100 1312€ Pub
228-10597-1 Recombinant HAV P2C Proteins Ray Biotech 100 240 228-10597-1 Recombinant HAV P2C Proteins Ray Biotech 100 240€
ASK
Pub
228-10597-3 Recombinant HAV P2C Proteins Ray Biotech 1000 1031 228-10597-3 Recombinant HAV P2C Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10598-1 Recombinant HAV P2C-P3A Proteins Ray Biotech 100 240 228-10598-1 Recombinant HAV P2C-P3A Proteins Ray Biotech 100 240€
ASK
Pub
228-10598-3 Recombinant HAV P2C-P3A Proteins Ray Biotech 1000 1031 228-10598-3 Recombinant HAV P2C-P3A Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10599-1 Recombinant HAV P2C-P3B Proteins Ray Biotech 100 240 228-10599-1 Recombinant HAV P2C-P3B Proteins Ray Biotech 100 240€
ASK
Pub
228-10599-3 Recombinant HAV P2C-P3B Proteins Ray Biotech 1000 1244 228-10599-3 Recombinant HAV P2C-P3B Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10600-1 Recombinant HAV P3C Proteins Ray Biotech 100 240 228-10600-1 Recombinant HAV P3C Proteins Ray Biotech 100 240€
ASK
Pub
228-10600-3 Recombinant HAV P3C Proteins Ray Biotech 1000 1031 228-10600-3 Recombinant HAV P3C Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10601-1 Recombinant HAV VP1 Proteins Ray Biotech 100 240 228-10601-1 Recombinant HAV VP1 Proteins Ray Biotech 100 240€
ASK
Pub
228-10601-3 Recombinant HAV VP1 Proteins Ray Biotech 1000 1031 228-10601-3 Recombinant HAV VP1 Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10602-1 Recombinant HAV VP1-P2A Proteins Ray Biotech 100 240 228-10602-1 Recombinant HAV VP1-P2A Proteins Ray Biotech 100 240€
ASK
Pub
228-10602-3 Recombinant HAV VP1-P2A Proteins Ray Biotech 1000 1031 228-10602-3 Recombinant HAV VP1-P2A Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10603-1 Recombinant HAV VP1-P2A Proteins Ray Biotech 100 240 228-10603-1 Recombinant HAV VP1-P2A Proteins Ray Biotech 100 240€
ASK
Pub
228-10603-3 Recombinant HAV VP1-P2A Proteins Ray Biotech 1000 1244 228-10603-3 Recombinant HAV VP1-P2A Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10604-1 Recombinant HAV VP3 Proteins Ray Biotech 100 240 228-10604-1 Recombinant HAV VP3 Proteins Ray Biotech 100 240€
ASK
Pub
228-10604-3 Recombinant HAV VP3 Proteins Ray Biotech 1000 1031 228-10604-3 Recombinant HAV VP3 Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10605-1 Recombinant HAV VP4-VP2 Proteins Ray Biotech 100 147 228-10605-1 Recombinant HAV VP4-VP2 Proteins Ray Biotech 100 147€
ASK
Pub
228-10605-3 Recombinant HAV VP4-VP2 Proteins Ray Biotech 1000 1031 228-10605-3 Recombinant HAV VP4-VP2 Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10607-1 Recombinant HBcAg Proteins Ray Biotech 100 240 228-10607-1 Recombinant HBcAg Proteins Ray Biotech 100 240€ Pub
228-10607-3 Recombinant HBcAg Proteins Ray Biotech 1000 1244 228-10607-3 Recombinant HBcAg Proteins Ray Biotech 1000 1244€ Pub
228-10608-1 Recombinant HBcAg Proteins Ray Biotech 100 240 228-10608-1 Recombinant HBcAg Proteins Ray Biotech 100 240€ Pub
228-10608-3 Recombinant HBcAg Proteins Ray Biotech 1000 1031 228-10608-3 Recombinant HBcAg Proteins Ray Biotech 1000 1031€ Pub
228-10609-1 Recombinant HBcAg delta Proteins Ray Biotech 100 147 228-10609-1 Recombinant HBcAg delta Proteins Ray Biotech 100 147€ Pub
228-10609-3 Recombinant HBcAg delta Proteins Ray Biotech 1000 1244 228-10609-3 Recombinant HBcAg delta Proteins Ray Biotech 1000 1244€ Pub
228-10610-3 Recombinant HBeAg Proteins Ray Biotech 1000 2426 228-10610-3 Recombinant HBeAg Proteins Ray Biotech 1000 2426€
ASK
Pub
228-10612-2 Recombinant HBsAg adr [from CHO cells] Proteins Ray Biotech 100 205 228-10612-2 Recombinant HBsAg adr [from CHO cells] Proteins Ray Biotech 100 205€ Pub
228-10613-2 Recombinant HBsAg adw Proteins Ray Biotech 100 205 228-10613-2 Recombinant HBsAg adw Proteins Ray Biotech 100 205€ Pub
228-10619-1 Recombinant HBeAg Proteins Ray Biotech 100 147 228-10619-1 Recombinant HBeAg Proteins Ray Biotech 100 147€ Pub
228-10619-3 Recombinant HBeAg Proteins Ray Biotech 1000 1031 228-10619-3 Recombinant HBeAg Proteins Ray Biotech 1000 1031€ Pub
228-10620-3 Recombinant HBx Proteins Ray Biotech 1000 0 228-10620-3 Recombinant HBx Proteins Ray Biotech 1000 0€
ASK
Pub
228-10624-1 Recombinant HCV 22kDa Proteins Ray Biotech 100 353 228-10624-1 Recombinant HCV 22kDa Proteins Ray Biotech 100 353€ Pub
228-10624-3 Recombinant HCV 22kDa Proteins Ray Biotech 1000 1244 228-10624-3 Recombinant HCV 22kDa Proteins Ray Biotech 1000 1244€ Pub
228-10625-1 Recombinant HCV 22kDa Proteins Ray Biotech 100 353 228-10625-1 Recombinant HCV 22kDa Proteins Ray Biotech 100 353€
ASK
Pub
228-10625-3 Recombinant HCV 22kDa Proteins Ray Biotech 1000 1452 228-10625-3 Recombinant HCV 22kDa Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10626-1 Recombinant HCV 22kDa Proteins Ray Biotech 100 353 228-10626-1 Recombinant HCV 22kDa Proteins Ray Biotech 100 353€
ASK
Pub
228-10626-3 Recombinant HCV 22kDa Proteins Ray Biotech 1000 1452 228-10626-3 Recombinant HCV 22kDa Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10627-1 Recombinant HCV 22kDa Proteins Ray Biotech 100 240 228-10627-1 Recombinant HCV 22kDa Proteins Ray Biotech 100 240€
ASK
Pub
228-10627-3 Recombinant HCV 22kDa Proteins Ray Biotech 1000 1452 228-10627-3 Recombinant HCV 22kDa Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10628-1 Recombinant HCV Proteins Ray Biotech 100 353 228-10628-1 Recombinant HCV Proteins Ray Biotech 100 353€ Pub
228-10628-3 Recombinant HCV Proteins Ray Biotech 1000 1031 228-10628-3 Recombinant HCV Proteins Ray Biotech 1000 1031€ Pub
228-10630-1 Recombinant HCV Core Proteins Ray Biotech 100 353 228-10630-1 Recombinant HCV Core Proteins Ray Biotech 100 353€
ASK
Pub
228-10630-3 Recombinant HCV Core Proteins Ray Biotech 1000 1452 228-10630-3 Recombinant HCV Core Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10631-1 Recombinant HCV Core Proteins Ray Biotech 100 240 228-10631-1 Recombinant HCV Core Proteins Ray Biotech 100 240€
ASK
Pub
228-10631-3 Recombinant HCV Core Proteins Ray Biotech 1000 1452 228-10631-3 Recombinant HCV Core Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10633-1 Recombinant HCV Genotype-1a Proteins Ray Biotech 100 240 228-10633-1 Recombinant HCV Genotype-1a Proteins Ray Biotech 100 240€ Pub
228-10633-3 Recombinant HCV Genotype-1a Proteins Ray Biotech 1000 1244 228-10633-3 Recombinant HCV Genotype-1a Proteins Ray Biotech 1000 1244€ Pub
228-10637-1 Recombinant HCV Genotype-3 10 Proteins Ray Biotech 100 240 228-10637-1 Recombinant HCV Genotype-3 10 Proteins Ray Biotech 100 240€
ASK
Pub
228-10637-3 Recombinant HCV Genotype-3 10 Proteins Ray Biotech 1000 1244 228-10637-3 Recombinant HCV Genotype-3 10 Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10643-1 Recombinant HCV NS3 Proteins Ray Biotech 100 240 228-10643-1 Recombinant HCV NS3 Proteins Ray Biotech 100 240€
ASK
Pub
228-10643-3 Recombinant HCV NS3 Proteins Ray Biotech 1000 1244 228-10643-3 Recombinant HCV NS3 Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10644-1 Recombinant HCV NS3 Genotype-1a Proteins Ray Biotech 100 240 228-10644-1 Recombinant HCV NS3 Genotype-1a Proteins Ray Biotech 100 240€
ASK
Pub
228-10644-3 Recombinant HCV NS3 Genotype-1a Proteins Ray Biotech 1000 1244 228-10644-3 Recombinant HCV NS3 Genotype-1a Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10645-1 Recombinant HCV NS3 Genotype-1a Proteins Ray Biotech 100 240 228-10645-1 Recombinant HCV NS3 Genotype-1a Proteins Ray Biotech 100 240€
ASK
Pub
228-10645-3 Recombinant HCV NS3 Genotype-1a Proteins Ray Biotech 1000 1244 228-10645-3 Recombinant HCV NS3 Genotype-1a Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10646-1 Recombinant HCV NS3 Genotype-1b Proteins Ray Biotech 100 240 228-10646-1 Recombinant HCV NS3 Genotype-1b Proteins Ray Biotech 100 240€
ASK
Pub
228-10646-3 Recombinant HCV NS3 Genotype-1b Proteins Ray Biotech 1000 1244 228-10646-3 Recombinant HCV NS3 Genotype-1b Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10647-1 Recombinant HCV NS3 Genotype-1b Proteins Ray Biotech 100 240 228-10647-1 Recombinant HCV NS3 Genotype-1b Proteins Ray Biotech 100 240€
ASK
Pub
228-10647-3 Recombinant HCV NS3 Genotype-1b Proteins Ray Biotech 1000 1244 228-10647-3 Recombinant HCV NS3 Genotype-1b Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10649-1 Recombinant HCV NS3 Genotype-1c Proteins Ray Biotech 100 240 228-10649-1 Recombinant HCV NS3 Genotype-1c Proteins Ray Biotech 100 240€
ASK
Pub
228-10649-3 Recombinant HCV NS3 Genotype-1c Proteins Ray Biotech 1000 1031 228-10649-3 Recombinant HCV NS3 Genotype-1c Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10650-1 Recombinant HCV NS3 Genotype-2b Proteins Ray Biotech 100 240 228-10650-1 Recombinant HCV NS3 Genotype-2b Proteins Ray Biotech 100 240€
ASK
Pub
228-10650-3 Recombinant HCV NS3 Genotype-2b Proteins Ray Biotech 1000 1244 228-10650-3 Recombinant HCV NS3 Genotype-2b Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10651-1 Recombinant HCV NS3 Genotype-2b Proteins Ray Biotech 100 240 228-10651-1 Recombinant HCV NS3 Genotype-2b Proteins Ray Biotech 100 240€
ASK
Pub
228-10651-3 Recombinant HCV NS3 Genotype-2b Proteins Ray Biotech 1000 1244 228-10651-3 Recombinant HCV NS3 Genotype-2b Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10652-1 Recombinant HCV NS3 Genotype-2c Proteins Ray Biotech 100 240 228-10652-1 Recombinant HCV NS3 Genotype-2c Proteins Ray Biotech 100 240€
ASK
Pub
228-10652-3 Recombinant HCV NS3 Genotype-2c Proteins Ray Biotech 1000 1244 228-10652-3 Recombinant HCV NS3 Genotype-2c Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10653-1 Recombinant HCV NS3 Genotype-2c Proteins Ray Biotech 100 240 228-10653-1 Recombinant HCV NS3 Genotype-2c Proteins Ray Biotech 100 240€
ASK
Pub
228-10653-3 Recombinant HCV NS3 Genotype-2c Proteins Ray Biotech 1000 1244 228-10653-3 Recombinant HCV NS3 Genotype-2c Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10654-1 Recombinant HCV NS3 Genotype-3 Proteins Ray Biotech 100 240 228-10654-1 Recombinant HCV NS3 Genotype-3 Proteins Ray Biotech 100 240€
ASK
Pub
228-10654-3 Recombinant HCV NS3 Genotype-3 Proteins Ray Biotech 1000 1244 228-10654-3 Recombinant HCV NS3 Genotype-3 Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10655-1 Recombinant HCV NS3 Genotype-4 Proteins Ray Biotech 100 240 228-10655-1 Recombinant HCV NS3 Genotype-4 Proteins Ray Biotech 100 240€ Pub
228-10655-3 Recombinant HCV NS3 Genotype-4 Proteins Ray Biotech 1000 1244 228-10655-3 Recombinant HCV NS3 Genotype-4 Proteins Ray Biotech 1000 1244€ Pub
228-10656-1 Recombinant HCV NS3 Genotype-5 Proteins Ray Biotech 100 240 228-10656-1 Recombinant HCV NS3 Genotype-5 Proteins Ray Biotech 100 240€
ASK
Pub
228-10656-3 Recombinant HCV NS3 Genotype-5 Proteins Ray Biotech 1000 1244 228-10656-3 Recombinant HCV NS3 Genotype-5 Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10658-1 Recombinant HCV NS3 Genotype-5a Proteins Ray Biotech 100 240 228-10658-1 Recombinant HCV NS3 Genotype-5a Proteins Ray Biotech 100 240€
ASK
Pub
228-10658-3 Recombinant HCV NS3 Genotype-5a Proteins Ray Biotech 1000 1031 228-10658-3 Recombinant HCV NS3 Genotype-5a Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10659-1 Recombinant HCV NS3 Genotype-6 Proteins Ray Biotech 100 240 228-10659-1 Recombinant HCV NS3 Genotype-6 Proteins Ray Biotech 100 240€
ASK
Pub
228-10659-3 Recombinant HCV NS3 Genotype-6 Proteins Ray Biotech 1000 1244 228-10659-3 Recombinant HCV NS3 Genotype-6 Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10660-1 Recombinant HCV NS3 Genotype-6a Proteins Ray Biotech 100 353 228-10660-1 Recombinant HCV NS3 Genotype-6a Proteins Ray Biotech 100 353€
ASK
Pub
228-10660-3 Recombinant HCV NS3 Genotype-6a Proteins Ray Biotech 1000 1244 228-10660-3 Recombinant HCV NS3 Genotype-6a Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10661-1 Recombinant HCV NS3 Proteins Ray Biotech 100 353 228-10661-1 Recombinant HCV NS3 Proteins Ray Biotech 100 353€
ASK
Pub
228-10661-3 Recombinant HCV NS3 Proteins Ray Biotech 1000 1452 228-10661-3 Recombinant HCV NS3 Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10662-1 Recombinant HCV NS3 Proteins Ray Biotech 100 240 228-10662-1 Recombinant HCV NS3 Proteins Ray Biotech 100 240€
ASK
Pub
228-10662-3 Recombinant HCV NS3 Proteins Ray Biotech 1000 1452 228-10662-3 Recombinant HCV NS3 Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10663-1 Recombinant HCV NS4 Proteins Ray Biotech 100 240 228-10663-1 Recombinant HCV NS4 Proteins Ray Biotech 100 240€
ASK
Pub
228-10663-3 Recombinant HCV NS4 Proteins Ray Biotech 1000 1244 228-10663-3 Recombinant HCV NS4 Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10664-1 Recombinant HCV NS4 a+b Proteins Ray Biotech 100 353 228-10664-1 Recombinant HCV NS4 a+b Proteins Ray Biotech 100 353€
ASK
Pub
228-10664-3 Recombinant HCV NS4 a+b Proteins Ray Biotech 1000 1244 228-10664-3 Recombinant HCV NS4 a+b Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10665-1 Recombinant HCV NS4 a+b Proteins Ray Biotech 100 353 228-10665-1 Recombinant HCV NS4 a+b Proteins Ray Biotech 100 353€
ASK
Pub
228-10665-3 Recombinant HCV NS4 a+b Proteins Ray Biotech 1000 1452 228-10665-3 Recombinant HCV NS4 a+b Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10666-1 Recombinant HCV NS4 a+b Proteins Ray Biotech 100 353 228-10666-1 Recombinant HCV NS4 a+b Proteins Ray Biotech 100 353€
ASK
Pub
228-10666-3 Recombinant HCV NS4 a+b Proteins Ray Biotech 1000 1452 228-10666-3 Recombinant HCV NS4 a+b Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10667-1 Recombinant HCV NS4 a+b Proteins Ray Biotech 100 240 228-10667-1 Recombinant HCV NS4 a+b Proteins Ray Biotech 100 240€
ASK
Pub
228-10667-3 Recombinant HCV NS4 a+b Proteins Ray Biotech 1000 1452 228-10667-3 Recombinant HCV NS4 a+b Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10668-1 Recombinant HCV NS4 Genotype-1 Proteins Ray Biotech 100 240 228-10668-1 Recombinant HCV NS4 Genotype-1 Proteins Ray Biotech 100 240€
ASK
Pub
228-10668-3 Recombinant HCV NS4 Genotype-1 Proteins Ray Biotech 1000 1244 228-10668-3 Recombinant HCV NS4 Genotype-1 Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10669-1 Recombinant HCV NS4 Genotype-2 Proteins Ray Biotech 100 240 228-10669-1 Recombinant HCV NS4 Genotype-2 Proteins Ray Biotech 100 240€
ASK
Pub
228-10669-3 Recombinant HCV NS4 Genotype-2 Proteins Ray Biotech 1000 1244 228-10669-3 Recombinant HCV NS4 Genotype-2 Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10670-1 Recombinant HCV NS4 Genotype-3 Proteins Ray Biotech 100 240 228-10670-1 Recombinant HCV NS4 Genotype-3 Proteins Ray Biotech 100 240€
ASK
Pub
228-10670-3 Recombinant HCV NS4 Genotype-3 Proteins Ray Biotech 1000 1244 228-10670-3 Recombinant HCV NS4 Genotype-3 Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10671-1 Recombinant HCV NS4 Genotype-5 Proteins Ray Biotech 100 353 228-10671-1 Recombinant HCV NS4 Genotype-5 Proteins Ray Biotech 100 353€
ASK
Pub
228-10671-3 Recombinant HCV NS4 Genotype-5 Proteins Ray Biotech 1000 1244 228-10671-3 Recombinant HCV NS4 Genotype-5 Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10672-1 Recombinant HCV NS4 [+HRP] Proteins Ray Biotech 100 240 228-10672-1 Recombinant HCV NS4 [+HRP] Proteins Ray Biotech 100 240€
ASK
Pub
228-10672-3 Recombinant HCV NS4 [+HRP] Proteins Ray Biotech 1000 1452 228-10672-3 Recombinant HCV NS4 [+HRP] Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10673-1 Recombinant HCV NS4 Proteins Ray Biotech 100 240 228-10673-1 Recombinant HCV NS4 Proteins Ray Biotech 100 240€
ASK
Pub
228-10673-3 Recombinant HCV NS4 Proteins Ray Biotech 1000 1031 228-10673-3 Recombinant HCV NS4 Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10674-1 Recombinant HCV NS5 Proteins Ray Biotech 100 353 228-10674-1 Recombinant HCV NS5 Proteins Ray Biotech 100 353€ Pub
228-10674-3 Recombinant HCV NS5 Proteins Ray Biotech 1000 1244 228-10674-3 Recombinant HCV NS5 Proteins Ray Biotech 1000 1244€ Pub
228-10675-1 Recombinant HCV NS5 Proteins Ray Biotech 100 240 228-10675-1 Recombinant HCV NS5 Proteins Ray Biotech 100 240€
ASK
Pub
228-10675-3 Recombinant HCV NS5 Proteins Ray Biotech 1000 1452 228-10675-3 Recombinant HCV NS5 Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10676-1 Recombinant HCV NS5 Genotype-1 Proteins Ray Biotech 100 240 228-10676-1 Recombinant HCV NS5 Genotype-1 Proteins Ray Biotech 100 240€
ASK
Pub
228-10676-3 Recombinant HCV NS5 Genotype-1 Proteins Ray Biotech 1000 1031 228-10676-3 Recombinant HCV NS5 Genotype-1 Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10678-1 Recombinant HCV NS5 Genotype-1a Proteins Ray Biotech 100 240 228-10678-1 Recombinant HCV NS5 Genotype-1a Proteins Ray Biotech 100 240€
ASK
Pub
228-10678-3 Recombinant HCV NS5 Genotype-1a Proteins Ray Biotech 1000 1031 228-10678-3 Recombinant HCV NS5 Genotype-1a Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10679-1 Recombinant HCV NS5 Genotype-1b Proteins Ray Biotech 100 240 228-10679-1 Recombinant HCV NS5 Genotype-1b Proteins Ray Biotech 100 240€
ASK
Pub
228-10679-3 Recombinant HCV NS5 Genotype-1b Proteins Ray Biotech 1000 1244 228-10679-3 Recombinant HCV NS5 Genotype-1b Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10680-1 Recombinant HCV NS5 Genotype-2 Proteins Ray Biotech 100 240 228-10680-1 Recombinant HCV NS5 Genotype-2 Proteins Ray Biotech 100 240€
ASK
Pub
228-10680-3 Recombinant HCV NS5 Genotype-2 Proteins Ray Biotech 1000 1031 228-10680-3 Recombinant HCV NS5 Genotype-2 Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10681-1 Recombinant HCV NS5 Genotype-2a Proteins Ray Biotech 100 240 228-10681-1 Recombinant HCV NS5 Genotype-2a Proteins Ray Biotech 100 240€
ASK
Pub
228-10681-3 Recombinant HCV NS5 Genotype-2a Proteins Ray Biotech 1000 1244 228-10681-3 Recombinant HCV NS5 Genotype-2a Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10682-1 Recombinant HCV NS5 Genotype-2b Proteins Ray Biotech 100 240 228-10682-1 Recombinant HCV NS5 Genotype-2b Proteins Ray Biotech 100 240€
ASK
Pub
228-10682-3 Recombinant HCV NS5 Genotype-2b Proteins Ray Biotech 1000 1244 228-10682-3 Recombinant HCV NS5 Genotype-2b Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10683-1 Recombinant HCV NS5 Genotype-3 Proteins Ray Biotech 100 240 228-10683-1 Recombinant HCV NS5 Genotype-3 Proteins Ray Biotech 100 240€
ASK
Pub
228-10683-3 Recombinant HCV NS5 Genotype-3 Proteins Ray Biotech 1000 1031 228-10683-3 Recombinant HCV NS5 Genotype-3 Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10684-1 Recombinant HCV NS5 Genotype-3a Proteins Ray Biotech 100 240 228-10684-1 Recombinant HCV NS5 Genotype-3a Proteins Ray Biotech 100 240€
ASK
Pub
228-10684-3 Recombinant HCV NS5 Genotype-3a Proteins Ray Biotech 1000 1244 228-10684-3 Recombinant HCV NS5 Genotype-3a Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10685-1 Recombinant HCV NS5 Genotype-3b Proteins Ray Biotech 100 240 228-10685-1 Recombinant HCV NS5 Genotype-3b Proteins Ray Biotech 100 240€
ASK
Pub
228-10685-3 Recombinant HCV NS5 Genotype-3b Proteins Ray Biotech 1000 1244 228-10685-3 Recombinant HCV NS5 Genotype-3b Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10686-1 Recombinant HCV NS5 Genotype-4 Proteins Ray Biotech 100 240 228-10686-1 Recombinant HCV NS5 Genotype-4 Proteins Ray Biotech 100 240€
ASK
Pub
228-10686-3 Recombinant HCV NS5 Genotype-4 Proteins Ray Biotech 1000 1244 228-10686-3 Recombinant HCV NS5 Genotype-4 Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10687-1 Recombinant HCV NS5 Genotype-5 Proteins Ray Biotech 100 240 228-10687-1 Recombinant HCV NS5 Genotype-5 Proteins Ray Biotech 100 240€
ASK
Pub
228-10687-3 Recombinant HCV NS5 Genotype-5 Proteins Ray Biotech 1000 1244 228-10687-3 Recombinant HCV NS5 Genotype-5 Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10688-1 Recombinant HCV NS5 Genotype-6 Proteins Ray Biotech 100 240 228-10688-1 Recombinant HCV NS5 Genotype-6 Proteins Ray Biotech 100 240€
ASK
Pub
228-10688-3 Recombinant HCV NS5 Genotype-6 Proteins Ray Biotech 1000 1031 228-10688-3 Recombinant HCV NS5 Genotype-6 Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10689-1 Recombinant HCV NS5 Genotype-6a Proteins Ray Biotech 100 353 228-10689-1 Recombinant HCV NS5 Genotype-6a Proteins Ray Biotech 100 353€
ASK
Pub
228-10689-3 Recombinant HCV NS5 Genotype-6a Proteins Ray Biotech 1000 1244 228-10689-3 Recombinant HCV NS5 Genotype-6a Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10690-1 Recombinant HCV NS5 Proteins Ray Biotech 100 147 228-10690-1 Recombinant HCV NS5 Proteins Ray Biotech 100 147€
ASK
Pub
228-10690-3 Recombinant HCV NS5 Proteins Ray Biotech 1000 1452 228-10690-3 Recombinant HCV NS5 Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10692-2 Native Human HDL Proteins Ray Biotech 100mg 485 228-10692-2 Native Human HDL Proteins Ray Biotech 100mg 485€ Pub
228-10695-1 Recombinant HEV ORF2 (aa 403-461) Proteins Ray Biotech 100 240 228-10695-1 Recombinant HEV ORF2 (aa 403-461) Proteins Ray Biotech 100 240€
ASK
Pub
228-10695-3 Recombinant HEV ORF2 (aa 403-461) Proteins Ray Biotech 1000 1244 228-10695-3 Recombinant HEV ORF2 (aa 403-461) Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10696-1 Recombinant HEV ORF2 (aa 452-617) Proteins Ray Biotech 100 240 228-10696-1 Recombinant HEV ORF2 (aa 452-617) Proteins Ray Biotech 100 240€
ASK
Pub
228-10696-3 Recombinant HEV ORF2 (aa 452-617) Proteins Ray Biotech 1000 1244 228-10696-3 Recombinant HEV ORF2 (aa 452-617) Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10697-1 Recombinant HEV ORF2 (aa 633-659) Proteins Ray Biotech 100 240 228-10697-1 Recombinant HEV ORF2 (aa 633-659) Proteins Ray Biotech 100 240€
ASK
Pub
228-10697-3 Recombinant HEV ORF2 (aa 633-659) Proteins Ray Biotech 1000 1244 228-10697-3 Recombinant HEV ORF2 (aa 633-659) Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10698-1 Recombinant HEV ORF2 + ORF3 Proteins Ray Biotech 100 240 228-10698-1 Recombinant HEV ORF2 + ORF3 Proteins Ray Biotech 100 240€
ASK
Pub
228-10698-3 Recombinant HEV ORF2 + ORF3 Proteins Ray Biotech 1000 1031 228-10698-3 Recombinant HEV ORF2 + ORF3 Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10699-1 Recombinant HEV ORF2 + ORF3 Proteins Ray Biotech 100 240 228-10699-1 Recombinant HEV ORF2 + ORF3 Proteins Ray Biotech 100 240€ Pub
228-10699-3 Recombinant HEV ORF2 + ORF3 Proteins Ray Biotech 1000 1031 228-10699-3 Recombinant HEV ORF2 + ORF3 Proteins Ray Biotech 1000 1031€ Pub
228-10700-1 Recombinant HEV ORF3 Proteins Ray Biotech 100 386 228-10700-1 Recombinant HEV ORF3 Proteins Ray Biotech 100 386€
ASK
Pub
228-10700-3 Recombinant HEV ORF3 Proteins Ray Biotech 1000 1031 228-10700-3 Recombinant HEV ORF3 Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10712-1 Recombinant HIV Type-O Envelope Proteins Ray Biotech 100 240 228-10712-1 Recombinant HIV Type-O Envelope Proteins Ray Biotech 100 240€
ASK
Pub
228-10712-3 Recombinant HIV Type-O Envelope Proteins Ray Biotech 1000 1031 228-10712-3 Recombinant HIV Type-O Envelope Proteins Ray Biotech 1000 1031€
ASK
Pub
228-10713-1 Recombinant HIV Type-O gp41 Proteins Ray Biotech 100 240 228-10713-1 Recombinant HIV Type-O gp41 Proteins Ray Biotech 100 240€
ASK
Pub
228-10713-3 Recombinant HIV Type-O gp41 Proteins Ray Biotech 1000 1244 228-10713-3 Recombinant HIV Type-O gp41 Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10714-1 Recombinant HIV Type-O gp41 [MBP-fusion] Proteins Ray Biotech 100 353 228-10714-1 Recombinant HIV Type-O gp41 [MBP-fusion] Proteins Ray Biotech 100 353€
ASK
Pub
228-10714-3 Recombinant HIV Type-O gp41 [MBP-fusion] Proteins Ray Biotech 1000 733 228-10714-3 Recombinant HIV Type-O gp41 [MBP-fusion] Proteins Ray Biotech 1000 733€
ASK
Pub
228-10715-1 Recombinant HIV-1 p24 [+HRP] Proteins Ray Biotech 100 240 228-10715-1 Recombinant HIV-1 p24 [+HRP] Proteins Ray Biotech 100 240€
ASK
Pub
228-10715-3 Recombinant HIV-1 p24 [+HRP] Proteins Ray Biotech 1000 1452 228-10715-3 Recombinant HIV-1 p24 [+HRP] Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10716-1 Recombinant HIV-1 Envelope [+His] Proteins Ray Biotech 100 240 228-10716-1 Recombinant HIV-1 Envelope [+His] Proteins Ray Biotech 100 240€
ASK
Pub
228-10716-3 Recombinant HIV-1 [+His] Proteins Ray Biotech 1000 733 228-10716-3 Recombinant HIV-1 [+His] Proteins Ray Biotech 1000 733€
ASK
Pub
228-10717-1 Recombinant HIV-1 gp120 nef,Mosaic Proteins Ray Biotech 100 147 228-10717-1 Recombinant HIV-1 gp120 nef,Mosaic Proteins Ray Biotech 100 147€ Pub
228-10717-3 Recombinant HIV-1 gp120 nef ,Mosaic Proteins Ray Biotech 1000 1244 228-10717-3 Recombinant HIV-1 gp120 nef ,Mosaic Proteins Ray Biotech 1000 1244€ Pub
228-10718-3 Recombinant HIV-1 gp120 CM Proteins Ray Biotech 100 1658 228-10718-3 Recombinant HIV-1 gp120 CM Proteins Ray Biotech 100 1658€
ASK
Pub
228-10719-3 Recombinant HIV-1 gp120 LAV Proteins Ray Biotech 100 1658 228-10719-3 Recombinant HIV-1 gp120 LAV Proteins Ray Biotech 100 1658€ Pub
228-10720-3 Recombinant HIV-1 gp120 MN Proteins Ray Biotech 100 1658 228-10720-3 Recombinant HIV-1 gp120 MN Proteins Ray Biotech 100 1658€ Pub
228-10723-1 Recombinant HIV-1 gp41 Proteins Ray Biotech 100 353 228-10723-1 Recombinant HIV-1 gp41 Proteins Ray Biotech 100 353€ Pub
228-10723-3 Recombinant HIV-1 gp41 Proteins Ray Biotech 1000 1244 228-10723-3 Recombinant HIV-1 gp41 Proteins Ray Biotech 1000 1244€ Pub
228-10724-1 Recombinant HIV-1 gp41 [+Biotin] Proteins Ray Biotech 100 240 228-10724-1 Recombinant HIV-1 gp41 [+Biotin] Proteins Ray Biotech 100 240€ Pub
228-10724-3 Recombinant HIV-1 gp41 [+Biotin] Proteins Ray Biotech 1000 1452 228-10724-3 Recombinant HIV-1 gp41 [+Biotin] Proteins Ray Biotech 1000 1452€ Pub
228-10725-1 Recombinant HIV-1 gp41 [+His] Proteins Ray Biotech 100 353 228-10725-1 Recombinant HIV-1 gp41 [+His] Proteins Ray Biotech 100 353€
ASK
Pub
228-10725-3 Recombinant HIV-1 gp41 [+His] Proteins Ray Biotech 1000 733 228-10725-3 Recombinant HIV-1 gp41 [+His] Proteins Ray Biotech 1000 733€
ASK
Pub
228-10726-1 Recombinant HIV-1 gp41 [+HRP] Proteins Ray Biotech 100 353 228-10726-1 Recombinant HIV-1 gp41 [+HRP] Proteins Ray Biotech 100 353€
ASK
Pub
228-10726-3 Recombinant HIV-1 gp41 [+HRP] Proteins Ray Biotech 1000 1452 228-10726-3 Recombinant HIV-1 gp41 [+HRP] Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10727-1 Recombinant HIV-1 gp41 Long [+Biotin] Proteins Ray Biotech 100 353 228-10727-1 Recombinant HIV-1 gp41 Long [+Biotin] Proteins Ray Biotech 100 353€
ASK
Pub
228-10727-3 Recombinant HIV-1 gp41 Long [+Biotin] Proteins Ray Biotech 1000 1452 228-10727-3 Recombinant HIV-1 gp41 Long [+Biotin] Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10728-1 Recombinant HIV-1 gp41 Long [+HRP] Proteins Ray Biotech 100 240 228-10728-1 Recombinant HIV-1 gp41 Long [+HRP] Proteins Ray Biotech 100 240€
ASK
Pub
228-10728-3 Recombinant HIV-1 gp41 Long [+HRP] Proteins Ray Biotech 1000 1452 228-10728-3 Recombinant HIV-1 gp41 Long [+HRP] Proteins Ray Biotech 1000 1452€
ASK
Pub
228-10729-1 Recombinant HIV-1 gp41 Long (aa 513-674) Proteins Ray Biotech 100 240 228-10729-1 Recombinant HIV-1 gp41 Long (aa 513-674) Proteins Ray Biotech 100 240€
ASK
Pub
228-10729-3 Recombinant HIV-1 gp41 Long (aa 513-674.) Proteins Ray Biotech 1000 1244 228-10729-3 Recombinant HIV-1 gp41 Long (aa 513-674.) Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10730-1 Recombinant HIV-1 gp41 [MBP-fusion] Proteins Ray Biotech 100 240 228-10730-1 Recombinant HIV-1 gp41 [MBP-fusion] Proteins Ray Biotech 100 240€
ASK
Pub
228-10730-3 Recombinant HIV-1 gp41 [MBP-fusion] Proteins Ray Biotech 1000 733 228-10730-3 Recombinant HIV-1 gp41 [MBP-fusion] Proteins Ray Biotech 1000 733€
ASK
Pub
228-10731-1 Recombinant HIV-1 pol Integrase Proteins Ray Biotech 100 240 228-10731-1 Recombinant HIV-1 pol Integrase Proteins Ray Biotech 100 240€ Pub
228-10731-3 Recombinant HIV-1 pol Integrase Proteins Ray Biotech 1000 1244 228-10731-3 Recombinant HIV-1 pol Integrase Proteins Ray Biotech 1000 1244€ Pub
228-10732-1 Recombinant HIV-1 p31 Integrase Proteins Ray Biotech 100 240 228-10732-1 Recombinant HIV-1 p31 Integrase Proteins Ray Biotech 100 240€
ASK
Pub
228-10732-3 Recombinant HIV-1 p31 Integrase Proteins Ray Biotech 1000 1244 228-10732-3 Recombinant HIV-1 p31 Integrase Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10733-1 Recombinant HIV-1 nef Proteins Ray Biotech 100 147 228-10733-1 Recombinant HIV-1 nef Proteins Ray Biotech 100 147€
ASK
Pub
228-10733-3 Recombinant HIV-1 nef Proteins Ray Biotech 1000 1244 228-10733-3 Recombinant HIV-1 nef Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10734-3 Recombinant HIV-1 nef, Clade B Proteins Ray Biotech 100 1137 228-10734-3 Recombinant HIV-1 nef, Clade B Proteins Ray Biotech 100 1137€
ASK
Pub
228-10735-1 Recombinant HIV-1 gag p17, p24 Proteins Ray Biotech 100 240 228-10735-1 Recombinant HIV-1 gag p17, p24 Proteins Ray Biotech 100 240€ Pub
228-10735-3 Recombinant HIV-1 gag p17, p24 Proteins Ray Biotech 1000 1244 228-10735-3 Recombinant HIV-1 gag p17, p24 Proteins Ray Biotech 1000 1244€ Pub
228-10736-1 Recombinant HIV-1 gag p17, p24, gp120 Proteins Ray Biotech 100 240 228-10736-1 Recombinant HIV-1 gag p17, p24, gp120 Proteins Ray Biotech 100 240€
ASK
Pub
228-10736-3 Recombinant HIV-1 gag p17, p24, gp120 Proteins Ray Biotech 1000 1244 228-10736-3 Recombinant HIV-1 gag p17, p24, gp120 Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10737-1 Recombinant HIV-1 gag p17-p24, gp41-gp120 Proteins Ray Biotech 100 240 228-10737-1 Recombinant HIV-1 gag p17-p24, gp41-gp120 Proteins Ray Biotech 100 240€
ASK
Pub
  Cat_Number Product name Supplier Quantity Price PDF Pub