Product name :IgG Rabbit Polyclonal to Human Interferon á 2a

Catalog Number :RF0013-1

Quantity :1 mg

Price :1050.05 Eur

Pay now with :

Supplier :Argenvec

 

Product Name.
IgG Rabbit Polyclonal to Human Interferon α 2a

Description.
IgG Anti Human Interferon α 2a is developed in rabbit using recombinant Human Interferon α
2a expressed in plants. Purified IgG prepared by affinity chromatography on protein G.

Immunogen. CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVRKYFQRITLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Source.
Rabbit.

Clonality.
Polyclonal.

Formulation.
Provided as 0.2 μm sterile filtered solution in phosphate buffered saline. Lyophilized.

Packaging.
100 μg

Reconstitution.
100 μl distilled water to a final concentration of 1 mg/ml

Applications.