Product name :Blue Fluorescent Protein (BFP)

Catalog Number :4994-5000

Quantity :5 mg

Price :5405 Eur

Pay now with :

Supplier :Biovision

 

Alternate Names / Synonyms: BFP, Blue Fluorescence Protein

Gene Symbol:

Accession #:

Gene ID:

Source: E. coli

Appearance: Lyophilized protein

Physical Form Description: Freeze Dried

Molecular Weight: 29.0 kDa

Purity by SDS-PAGE: ≥97%

Purity by HPLC: ≥97%

Endotoxin Level: <0.1 ng/μg

Biological Activity: N/A

Reconstitution Instructions: Reconstitute with dH₂O to 1 mg/ml

Storage Temp.: -20°C

Shipping: Gel pack

Background Information: The recombinant Blue Fluorescent Protein (BFP) is expressed and purified from transformed E. coli using a method that ensures high purity and maximal BFP fluorescence. The protein is a 29 kDa monomer with 259 amino acids, pI: 6.17. Ex.= 308-383 nm; Em.= 440-447 nm. The protein is engineered with 6xHis-tag on the N-terminal, which can be used for detection with anti-His-Tag antibody, or protein removal by using Ni++ beads. BFP protein sequence:MGSSHHHHHHSSGLVPRGSHMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATY GKLTLKFICTTGKLPVPWPTLVTTLSHGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIF FKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNFNSHNVYIMADKQKN GIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDSHYLSTQSALSKDPNEKRDHMV LLEFVTAAGITLGMDELYK

Handling: Centrifuge the vial prior to opening.

Usage: For Research Use Only! Not to be used in humans.

datasheet of product :Blue Fluorescent Protein (BFP) Blue Fluorescent Protein (BFP)

Question about this product?

Name

Email Address

Message

Retype code:

random val Reload Image


[Related Products]Blue Fluorescent Protein (BFP)

Filter: (Type enter to validate)
  Cat_Number Product name Supplier Quantity Price Tech More
M02735 (2 Aminoethylamino) 1 naphthalene sulfonic acid (1,5 EDANS), Blue Green Fluorescent Labeling Reagent for Carbohydrates, Aldehydes, Ketones and Proteins, 10mgMarkerGene97 M0273 5 (2 Aminoethylamino) 1 naphthalene sulfonic acid (1,5 EDANS), Blue Green Fluorescent Labeling Reagent for Carbohydrates, Aldehydes, Ketones and Proteins, 10mg MarkerGene 97€
ASK
Pub
4994-5000Blue Fluorescent Protein (BFP)Biovision5 mg5405 4994-5000 Blue Fluorescent Protein (BFP) Biovision 5 mg 5405€ Pub
M08517 (Diethylamino)coumarin 3 carboxylic acid, Blue green fluorescent label for use in peptide and protein modification, 100mgMarkerGene134 M0851 7 (Diethylamino)coumarin 3 carboxylic acid, Blue green fluorescent label for use in peptide and protein modification, 100mg MarkerGene 134€
ASK
Pub
4998-100Yellow Fluorescent ProteinBiovision100 ug380 4998-100 Yellow Fluorescent Protein Biovision 100 ug 380€ Pub
FP-201-655Atto 655 Protein Labeling Kit, Kit Fluorescent labeling of primary amino groups Jena Bioscience10reactions 375 FP-201-655 Atto 655 Protein Labeling Kit, Kit Fluorescent labeling of primary amino groups Jena Bioscience 10reactions 375€
ASK
Pub
4996-1000Cyan Fluorescent ProteinBiovision1 mg1985 4996-1000 Cyan Fluorescent Protein Biovision 1 mg 1985€ Pub
4999-1000Enhanced Green Fluorescent Protein (EGFP)Biovision1 mg1895 4999-1000 Enhanced Green Fluorescent Protein (EGFP) Biovision 1 mg 1895€ Pub
PP-301S-425Atto425 PCR Labeling Kit, S pack Blue green fluorescent DNA labeling by PCR Jena Bioscience10reactions 135 PP-301S-425 Atto425 PCR Labeling Kit, S pack Blue green fluorescent DNA labeling by PCR Jena Bioscience 10reactions 135€
ASK
Pub
4997-5000dsRed Fluorescent ProteinBiovision5 mg5675 4997-5000 dsRed Fluorescent Protein Biovision 5 mg 5675€ Pub
FP-201-550Atto 550 Protein Labeling Kit, Kit Fluorescent labeling of primary amino groups Jena Bioscience10reactions 375 FP-201-550 Atto 550 Protein Labeling Kit, Kit Fluorescent labeling of primary amino groups Jena Bioscience 10reactions 375€
ASK
Pub
4996-100Cyan Fluorescent ProteinBiovision100 μg288.5 4996-100 Cyan Fluorescent Protein Biovision 100 μg 288.5€ Pub
4999-100Enhanced Green Fluorescent Protein (EGFP)Biovision100 μg306.5 4999-100 Enhanced Green Fluorescent Protein (EGFP) Biovision 100 μg 306.5€ Pub
4993-1000mCherry Fluorescent ProteinBiovision1 mg1895 4993-1000 mCherry Fluorescent Protein Biovision 1 mg 1895€ Pub
4997-1000dsRed Fluorescent ProteinBiovision1 mg1895 4997-1000 dsRed Fluorescent Protein Biovision 1 mg 1895€ Pub
2452Trypan Blue, sodium salt *UltraPure grade* *Purified to eliminate fluorescent impurities*AAT Bioquest10 g202 2452 Trypan Blue, sodium salt *UltraPure grade* *Purified to eliminate fluorescent impurities* AAT Bioquest 10 g 202€
ASK
Pub
K817-6-100Fluorescent Protein Antibody SetBiovision6 x 100 µg 1328 K817-6-100 Fluorescent Protein Antibody Set Biovision 6 x 100 µg 1328€ Pub
4998-5000Yellow Fluorescent ProteinBiovision5 mg5405 4998-5000 Yellow Fluorescent Protein Biovision 5 mg 5405€ Pub
11100Amplite™ Fluorimetric Fluorescamine Protein Quantitation Kit *Blue Fluorescence*AAT Bioquest1 kit124 11100 Amplite™ Fluorimetric Fluorescamine Protein Quantitation Kit *Blue Fluorescence* AAT Bioquest 1 kit 124€
ASK
Pub
M14569 (2,2 dicyanovinyl)julolidine, A fluorescent probe useful for binding to proteins, 5 mgMarkerGene95 M1456 9 (2,2 dicyanovinyl)julolidine, A fluorescent probe useful for binding to proteins, 5 mg MarkerGene 95€
ASK
Pub
M0525Pyrene N Hexadecylsulfonamide in vivo blue fluorescent probe, 25mgMarkerGene151 M0525 Pyrene N Hexadecylsulfonamide in vivo blue fluorescent probe, 25mg MarkerGene 151€
ASK
Pub
4997-100dsRed Fluorescent ProteinBiovision100 μg306.5 4997-100 dsRed Fluorescent Protein Biovision 100 μg 306.5€ Pub
K816-6-100Fluorescent Protein SetBiovision6x100 µg1105 K816-6-100 Fluorescent Protein Set Biovision 6x100 µg 1105€ Pub
4994-1000Blue Fluorescence Protein (BFP)Biovision1 mg2125 4994-1000 Blue Fluorescence Protein (BFP) Biovision 1 mg 2125€ Pub
M1036Fluorescein 5 thiosemicarbazide, Cell impermeant fluorescent probe for determining cell surface protein and peptide topology, 50 mgMarkerGene141 M1036 Fluorescein 5 thiosemicarbazide, Cell impermeant fluorescent probe for determining cell surface protein and peptide topology, 50 mg MarkerGene 141€
ASK
Pub
4998-1000Yellow Fluorescent ProteinBiovision1 mg1805 4998-1000 Yellow Fluorescent Protein Biovision 1 mg 1805€ Pub
M06385 (Iodoacetamido)fluorescein, Fluorescent Protein Labeling Dye, 25mgMarkerGene134 M0638 5 (Iodoacetamido)fluorescein, Fluorescent Protein Labeling Dye, 25mg MarkerGene 134€
ASK
Pub
4996-5000Cyan Fluorescent ProteinBiovision5 mg5405 4996-5000 Cyan Fluorescent Protein Biovision 5 mg 5405€ Pub
M-234Fluorescent 100 bp DNA Ladder100 bp 1 kb 500 µl, 100 ng µl ready to load, orange blue, green fluorescentJena Bioscience100lanes 77 M-234 Fluorescent 100 bp DNA Ladder100 bp 1 kb 500 µl, 100 ng µl ready to load, orange blue, green fluorescent Jena Bioscience 100lanes 77€
ASK
Pub
4999-5000Enhanced Green Fluorescent Protein (EGFP)Biovision5 mg5405 4999-5000 Enhanced Green Fluorescent Protein (EGFP) Biovision 5 mg 5405€ Pub
60-001anti GFP antibody, rat monoclonal The green fluorescent protein (GFP) is composed of 238 amino acids (26.9 kDa), originally isolated from the jellyfish Aequorea victoria that fluoresces green when expB-Bridge100 ug0 60-001 anti GFP antibody, rat monoclonal The green fluorescent protein (GFP) is composed of 238 amino acids (26.9 kDa), originally isolated from the jellyfish Aequorea victoria that fluoresces green when exp B-Bridge 100 ug 0€
ASK
Pub
4994-100Blue Fluorescence Protein (BFP)100 ugBiovision100 ug288 4994-100 Blue Fluorescence Protein (BFP)100 ug Biovision 100 ug 288€ Pub
228-10349-2Recombinant Mouse EBI3 Proteins Ray Biotech10240 228-10349-2 Recombinant Mouse EBI3 Proteins Ray Biotech 10 240€
ASK
Pub
rAP-0008-2VEGF (Rat) recombinant proteins AngoiPro2.00 ug133 rAP-0008-2 VEGF (Rat) recombinant proteins AngoiPro 2.00 ug 133€ Pub
DS-01-0418Native Bovine Thyroglobulin Proteins Ray Biotech100 mg353 DS-01-0418 Native Bovine Thyroglobulin Proteins Ray Biotech 100 mg 353€ Pub
230-00245-50 Proteins Ray Biotech50 229 230-00245-50 Proteins Ray Biotech 50 229€
ASK
Pub
228-10288-3Recombinant Human CTGF Proteins Ray Biotech1mg0 228-10288-3 Recombinant Human CTGF Proteins Ray Biotech 1mg 0€ Pub
230-00001-1000Recombinant Human SAA [from E. coli] Proteins Ray Biotech1000 0 230-00001-1000 Recombinant Human SAA [from E. coli] Proteins Ray Biotech 1000 0€ Pub
228-10222-1Recombinant Human CHGA Proteins Ray Biotech5205 228-10222-1 Recombinant Human CHGA Proteins Ray Biotech 5 205€
ASK
Pub
228-11585-1Recombinant Human UBE2K Proteins Ray Biotech2147 228-11585-1 Recombinant Human UBE2K Proteins Ray Biotech 2 147€
ASK
Pub
228-10119-2Recombinant Human BHMT Proteins Ray Biotech50205 228-10119-2 Recombinant Human BHMT Proteins Ray Biotech 50 205€
ASK
Pub
228-11498-3Recombinant Human TGF-beta 3 (aa 644-850) Proteins Ray Biotech10584 228-11498-3 Recombinant Human TGF-beta 3 (aa 644-850) Proteins Ray Biotech 10 584€
ASK
Pub
228-10043-3Recombinant Human ALT1 GPT Proteins Ray Biotech50U1658 228-10043-3 Recombinant Human ALT1 GPT Proteins Ray Biotech 50U 1658€ Pub
228-11423-1Recombinant Human SDF-1 beta CXCL12 (aa 3-72) [+His] Proteins Ray Biotech2147 228-11423-1 Recombinant Human SDF-1 beta CXCL12 (aa 3-72) [+His] Proteins Ray Biotech 2 147€
ASK
Pub
Y105168G Protein Coupled Receptor GPR61, Human ABM Goods50ug1174 Y105168 G Protein Coupled Receptor GPR61, Human ABM Goods 50ug 1174€
ASK
Pub
DI0588PRKCB & CHUK Protein Protein Interaction Antibody PairAbnova1 Set765 DI0588 PRKCB & CHUK Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11345-2Recombinant Human PTPN6 Proteins Ray Biotech20205 228-11345-2 Recombinant Human PTPN6 Proteins Ray Biotech 20 205€
ASK
Pub
Y052059Anti-ATM Protein Kinase phospho-ser1981 Fluorescein Conjugated AntibodyABM Goods100 μg396.9 Y052059 Anti-ATM Protein Kinase phospho-ser1981 Fluorescein Conjugated Antibody ABM Goods 100 μg 396.9€
ASK
Pub
DI0422KIT & PIK3CG Protein Protein Interaction Antibody PairAbnova1 Set765 DI0422 KIT & PIK3CG Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11271-1Recombinant Human PLA2G5 Proteins Ray Biotech2147 228-11271-1 Recombinant Human PLA2G5 Proteins Ray Biotech 2 147€
ASK
Pub
228-11072-3Recombinant Influenza HA (B Malaysia 2506 04) Proteins Ray Biotech1001658 228-11072-3 Recombinant Influenza HA (B Malaysia 2506 04) Proteins Ray Biotech 100 1658€
ASK
Pub
PP-305S-488Atto488 NT Labeling Kit, S pack Green fluorescent DNA labeling by nick translation Jena Bioscience10reactions 135 PP-305S-488 Atto488 NT Labeling Kit, S pack Green fluorescent DNA labeling by nick translation Jena Bioscience 10reactions 135€
ASK
Pub
DI0257TP53 & STK4 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0257 TP53 & STK4 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11206-2Recombinant Human PCNA [from Sf9] Proteins Ray Biotech20205 228-11206-2 Recombinant Human PCNA [from Sf9] Proteins Ray Biotech 20 205€ Pub
228-10974-2Recombinant Human IRF1 Proteins Ray Biotech20205 228-10974-2 Recombinant Human IRF1 Proteins Ray Biotech 20 205€
ASK
Pub
M108012 (7 Nitrobenzofurazan 4 ylamino)dodecanoic acid (C12 NBD), Fluorescent fatty acid, 100 mgMarkerGene201 M1080 12 (7 Nitrobenzofurazan 4 ylamino)dodecanoic acid (C12 NBD), Fluorescent fatty acid, 100 mg MarkerGene 201€
ASK
Pub
DI0094CDC6 & CDKN1A Protein Protein Interaction Antibody PairAbnova1 Set765 DI0094 CDC6 & CDKN1A Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-10894-1Recombinant Human IL-19 Proteins Ray Biotech2147 228-10894-1 Recombinant Human IL-19 Proteins Ray Biotech 2 147€
ASK
Pub
IR-MSCD1-GF-10mgCD-1 Mouse IgG - Protein A Purified 10mgInnovative Research INC245 IR-MSCD1-GF-10mg CD-1 Mouse IgG - Protein A Purified 10mg Innovative Research INC 245€ Pub
Cat.1016-50Adar's Protein A Beads Adar Biotech50 ml1268 Cat.1016-50 Adar's Protein A Beads Adar Biotech 50 ml 1268€
ASK
Pub
228-10799-2Recombinant HSV-2 gG Proteins Ray Biotech500601 228-10799-2 Recombinant HSV-2 gG Proteins Ray Biotech 500 601€
ASK
Pub
DP0270MYOD1(phospho S200) & MYOD1 Protein Phosphorylation Antibody PairAbnova1 Set834 DP0270 MYOD1(phospho S200) & MYOD1 Protein Phosphorylation Antibody Pair Abnova 1 Set 834€
ASK
Pub
bs-6983RRabbit Anti-WT-1 Wilms Tumor Protein Polyclonal AntibodySepax100ug Lyophilized222 bs-6983R Rabbit Anti-WT-1 Wilms Tumor Protein Polyclonal Antibody Sepax 100ug Lyophilized 222€ Pub
228-10736-2Recombinant HIV-1 gag p17, p24, gp120 Proteins Ray Biotech500601 228-10736-2 Recombinant HIV-1 gag p17, p24, gp120 Proteins Ray Biotech 500 601€
ASK
Pub
DP0087TP53(phospho S20) & TP53 Protein Phosphorylation Antibody PairAbnova1 Set834 DP0087 TP53(phospho S20) & TP53 Protein Phosphorylation Antibody Pair Abnova 1 Set 834€
ASK
Pub
bs-2017R-BiotinRabbit Anti-14-3-3 family protein Polyclonal Antibody, Biotin ConjugatedBioss100ug369 bs-2017R-Biotin Rabbit Anti-14-3-3 family protein Polyclonal Antibody, Biotin Conjugated Bioss 100ug 369€ Pub
228-10675-3Recombinant HCV NS5 Proteins Ray Biotech10001452 228-10675-3 Recombinant HCV NS5 Proteins Ray Biotech 1000 1452€
ASK
Pub
bs-0110R-PE-Cy5.5Rabbit Anti-APBB1 Fe65 protein Polyclonal Antibody, PE-Cy5.5 conjugated Isotype: IgGSepax100ug Lyophilized300 bs-0110R-PE-Cy5.5 Rabbit Anti-APBB1 Fe65 protein Polyclonal Antibody, PE-Cy5.5 conjugated Isotype: IgG Sepax 100ug Lyophilized 300€
ASK
Pub
228-10607-2Recombinant HBcAg Proteins Ray Biotech500601 228-10607-2 Recombinant HBcAg Proteins Ray Biotech 500 601€ Pub
6502-5Protein A G Biovision5 mg261.5 6502-5 Protein A G Biovision 5 mg 261.5€
ASK
Pub
228-10533-1Recombinant Mouse GH Proteins Ray Biotech100147 228-10533-1 Recombinant Mouse GH Proteins Ray Biotech 100 147€
ASK
Pub
22528zinc finger protein 574 antibody Source Rabbit Polyconal Ab Species Human Application WBSignalWay Antibody S.A.B 100ul329 22528 zinc finger protein 574 antibody Source Rabbit Polyconal Ab Species Human Application WB SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
228-10460-3Recombinant Mouse FGF21 Proteins Ray Biotech1mg0 228-10460-3 Recombinant Mouse FGF21 Proteins Ray Biotech 1mg 0€
ASK
Pub
rAP-0271-2sTie-1-Fc (rHuman) recombinant proteins AngoiPro2.00 ug133 rAP-0271-2 sTie-1-Fc (rHuman) recombinant proteins AngoiPro 2.00 ug 133€ Pub
MD-14-0210PRecombinant CMV gB (C194 Strain) Proteins Ray Biotech1 mg1172 MD-14-0210P Recombinant CMV gB (C194 Strain) Proteins Ray Biotech 1 mg 1172€
ASK
Pub
01-009E.coli RuvB Protein E.coli RuvB ProteinB-Bridge20 ug404.25 01-009 E.coli RuvB Protein E.coli RuvB Protein B-Bridge 20 ug 404.25€
ASK
Pub
228-10374-2Recombinant Human EMAP II Proteins Ray Biotech20205 228-10374-2 Recombinant Human EMAP II Proteins Ray Biotech 20 205€
ASK
Pub
rAP-0040-2PDGF-BB (Human) Yeast recombinant proteins AngoiPro2.00 ug133 rAP-0040-2 PDGF-BB (Human) Yeast recombinant proteins AngoiPro 2.00 ug 133€ Pub
IHBTPlasma Proteins: Human beta-thrombinInnovative Research INC1.0mg1103 IHBT Plasma Proteins: Human beta-thrombin Innovative Research INC 1.0mg 1103€ Pub
230-00510-50 Proteins Ray Biotech50 229 230-00510-50 Proteins Ray Biotech 50 229€
ASK
Pub
230-00202-100Recombinant Human Galectin-3 LGALS3 [from E. coli] Proteins Ray Biotech100 318 230-00202-100 Recombinant Human Galectin-3 LGALS3 [from E. coli] Proteins Ray Biotech 100 318€ Pub
228-10249-2Recombinant Rat CLU ApoJ Proteins Ray Biotech10205 228-10249-2 Recombinant Rat CLU ApoJ Proteins Ray Biotech 10 205€
ASK
Pub
228-11618-1Recombinant Human VEGF-121 VEGFA [+His] Proteins Ray Biotech2147 228-11618-1 Recombinant Human VEGF-121 VEGFA [+His] Proteins Ray Biotech 2 147€
ASK
Pub
228-10145-3Native Bovine BSA Proteins Ray Biotech100g292 228-10145-3 Native Bovine BSA Proteins Ray Biotech 100g 292€ Pub
228-11530-1Recombinant Human TNNT2 Proteins Ray Biotech5147 228-11530-1 Recombinant Human TNNT2 Proteins Ray Biotech 5 147€
ASK
Pub
228-10080-1Recombinant Human ATXN3 Proteins Ray Biotech2147 228-10080-1 Recombinant Human ATXN3 Proteins Ray Biotech 2 147€
ASK
Pub
228-11455-2Recombinant Human SPR Proteins Ray Biotech20205 228-11455-2 Recombinant Human SPR Proteins Ray Biotech 20 205€
ASK
Pub
228-10001-1Recombinant Human YWHAB Proteins Ray Biotech5147 228-10001-1 Recombinant Human YWHAB Proteins Ray Biotech 5 147€
ASK
Pub
228-11377-3Recombinant Rat Resistin Proteins Ray Biotech1mg0 228-11377-3 Recombinant Rat Resistin Proteins Ray Biotech 1mg 0€
ASK
Pub
Y075087Anti Ancient ubiquitous protein 1 (48 60)ABM Goods100 ul423.15 Y075087 Anti Ancient ubiquitous protein 1 (48 60) ABM Goods 100 ul 423.15€
ASK
Pub
DI0486MAPK12 & DUSP1 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0486 MAPK12 & DUSP1 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11302-1Recombinant Human PRDX5 Proteins Ray Biotech5147 228-11302-1 Recombinant Human PRDX5 Proteins Ray Biotech 5 147€
ASK
Pub
228-11116-2Recombinant Human MIP-1 beta CCL4 Proteins Ray Biotech10205 228-11116-2 Recombinant Human MIP-1 beta CCL4 Proteins Ray Biotech 10 205€
ASK
Pub
RH1P0001HIV-1 protease, Virus Active ProteinBiovendor0.1 mg390 RH1P0001 HIV-1 protease, Virus Active Protein Biovendor 0.1 mg 390€ Pub
DI0323IGF1R & MDM2 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0323 IGF1R & MDM2 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11233-3Recombinant Human pGH 22kDa Proteins Ray Biotech1mg1906 228-11233-3 Recombinant Human pGH 22kDa Proteins Ray Biotech 1mg 1906€
ASK
Pub
228-10999-3Recombinant Human KRT18 [+His] Proteins Ray Biotech1mg0 228-10999-3 Recombinant Human KRT18 [+His] Proteins Ray Biotech 1mg 0€
ASK
Pub
MD-05-0258Mouse Anti-HPV-16 E7 Protein Antibodies Ray Biotech1 mg485 MD-05-0258 Mouse Anti-HPV-16 E7 Protein Antibodies Ray Biotech 1 mg 485€
ASK
Pub
DI0161PTK2 & ERBB2 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0161 PTK2 & ERBB2 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11156-2Recombinant Human NGB Proteins Ray Biotech10205 228-11156-2 Recombinant Human NGB Proteins Ray Biotech 10 205€ Pub
228-10921-3Recombinant Human IL-3 [from Sf9] Proteins Ray Biotech1mg0 228-10921-3 Recombinant Human IL-3 [from Sf9] Proteins Ray Biotech 1mg 0€
ASK
Pub
L002-50UGThioStar™ Fluorescent Thiol SubstrateArbor Assays50 µg177 L002-50UG ThioStar™ Fluorescent Thiol Substrate Arbor Assays 50 µg 177€ Pub
CY-GF ANIMAL IMMUNOGLOBULINS , Cyno Monkey IgG, Protein A PurifiedMolecular Innovations10 mg219 CY-GF ANIMAL IMMUNOGLOBULINS , Cyno Monkey IgG, Protein A Purified Molecular Innovations 10 mg 219€ Pub
228-10831-1Recombinant Human IGF1 Proteins Ray Biotech20147 228-10831-1 Recombinant Human IGF1 Proteins Ray Biotech 20 147€ Pub
DS-PB-02341Goat Anti-Human RBP1-Like Protein Antibodies Ray Biotech0.1 mg568 DS-PB-02341 Goat Anti-Human RBP1-Like Protein Antibodies Ray Biotech 0.1 mg 568€
ASK
Pub
bs-7564R-PERabbit Anti-Azurocidin Cationic antimicrobial protein 37 Polyclonal Antibody, PE Conjugated , 27kDa; Isotype IgG; Reactivity Human; Application Flow-Cyt(1 20-100), IF(1 50-200)Bioss100ug Lyophilized502 bs-7564R-PE Rabbit Anti-Azurocidin Cationic antimicrobial protein 37 Polyclonal Antibody, PE Conjugated , 27kDa; Isotype IgG; Reactivity Human; Application Flow-Cyt(1 20-100), IF(1 50-200) Bioss 100ug Lyophilized 502€ Pub
228-10757-3Recombinant HIV-2 gp32 [+Biotin] Proteins Ray Biotech10001452 228-10757-3 Recombinant HIV-2 gp32 [+Biotin] Proteins Ray Biotech 1000 1452€
ASK
Pub
DP0156BAD(phospho S155) & BAD Protein Phosphorylation Antibody PairAbnova1 Set834 DP0156 BAD(phospho S155) & BAD Protein Phosphorylation Antibody Pair Abnova 1 Set 834€
ASK
Pub
bs-6347R-PE-Cy3Rabbit Anti-Rex1 Zinc finger protein 754 Polyclonal Antibody, PE-Cy3 Conjugated , 35-38kDa; Isotype IgG; Reactivity Human; Application Flow-Cyt(1 20-100), IF(1 50-200)Bioss100ug Lyophilized530 bs-6347R-PE-Cy3 Rabbit Anti-Rex1 Zinc finger protein 754 Polyclonal Antibody, PE-Cy3 Conjugated , 35-38kDa; Isotype IgG; Reactivity Human; Application Flow-Cyt(1 20-100), IF(1 50-200) Bioss 100ug Lyophilized 530€ Pub
228-10700-1Recombinant HEV ORF3 Proteins Ray Biotech100386 228-10700-1 Recombinant HEV ORF3 Proteins Ray Biotech 100 386€
ASK
Pub
bs-0602R-FITCRabbit Anti-Snake(Agkistrodonhaly) poison Protein Polyclonal Antibody, FITC conjugated,Isotype: IgGSepax100ug Lyophilized304 bs-0602R-FITC Rabbit Anti-Snake(Agkistrodonhaly) poison Protein Polyclonal Antibody, FITC conjugated,Isotype: IgG Sepax 100ug Lyophilized 304€ Pub
228-10633-3Recombinant HCV Genotype-1a Proteins Ray Biotech10001244 228-10633-3 Recombinant HCV Genotype-1a Proteins Ray Biotech 1000 1244€ Pub
7603-20DNA Binding Protein-7 (DBP-7), human recombinantBiovision20 μg236 7603-20 DNA Binding Protein-7 (DBP-7), human recombinant Biovision 20 μg 236€ Pub
228-10558-2Recombinant Human GMF-beta Proteins Ray Biotech10205 228-10558-2 Recombinant Human GMF-beta Proteins Ray Biotech 10 205€
ASK
Pub
23080leucine zipper protein 1 antibody Source Rabbit Polyconal Ab Species Human Application WBSignalWay Antibody S.A.B 100ul329 23080 leucine zipper protein 1 antibody Source Rabbit Polyconal Ab Species Human Application WB SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
228-10486-1Recombinant Human FLT1 VEGF R1 D7 Proteins Ray Biotech2147 228-10486-1 Recombinant Human FLT1 VEGF R1 D7 Proteins Ray Biotech 2 147€ Pub
RB-15-0001P-50Recombinant Human TIMP3 Proteins Ray Biotech50 229 RB-15-0001P-50 Recombinant Human TIMP3 Proteins Ray Biotech 50 229€ Pub
MD-14-0370PNative Human Serum (Cystatin-C Free) Proteins Ray Biotech50 mL667 MD-14-0370P Native Human Serum (Cystatin-C Free) Proteins Ray Biotech 50 mL 667€
ASK
Pub
100-170Human Gro g Macrophage Inflammatory Protein-2 beta Gro-γ MIP-2-β CXCL3Shenandoah Biotechnology, Inc.2ug113.4 100-170 Human Gro g Macrophage Inflammatory Protein-2 beta Gro-γ MIP-2-β CXCL3 Shenandoah Biotechnology, Inc. 2ug 113.4€ Pub
228-10420-1Recombinant Human CCL21 Proteins Ray Biotech5147 228-10420-1 Recombinant Human CCL21 Proteins Ray Biotech 5 147€ Pub
rAP-0072-2GM-CSF (Mouse) recombinant proteins AngoiPro2.00 ug133 rAP-0072-2 GM-CSF (Mouse) recombinant proteins AngoiPro 2.00 ug 133€ Pub
MD-05-0071PRecombinant HBcAg Proteins Ray Biotech100 790 MD-05-0071P Recombinant HBcAg Proteins Ray Biotech 100 790€ Pub
228-10334-3Recombinant E. coli HSP70 DnaK SBD Proteins Ray Biotech1mg1031 228-10334-3 Recombinant E. coli HSP70 DnaK SBD Proteins Ray Biotech 1mg 1031€
ASK
Pub
MD-27-0002PNative Human Apolipoprotein H APOH Proteins Ray Biotech1 mg766 MD-27-0002P Native Human Apolipoprotein H APOH Proteins Ray Biotech 1 mg 766€ Pub
DS-01-0277Native Human Laminin Proteins Ray Biotech0.1 mg353 DS-01-0277 Native Human Laminin Proteins Ray Biotech 0.1 mg 353€ Pub
230-00233-50Recombinant Human MDK [from E. coli] Proteins Ray Biotech50 229 230-00233-50 Recombinant Human MDK [from E. coli] Proteins Ray Biotech 50 229€ Pub
228-10277-2Recombinant Human CRMP-1 Proteins Ray Biotech5386 228-10277-2 Recombinant Human CRMP-1 Proteins Ray Biotech 5 386€
ASK
Pub
228-11648-3Recombinant WNV Envelope Proteins Ray Biotech10001244 228-11648-3 Recombinant WNV Envelope Proteins Ray Biotech 1000 1244€ Pub
228-10206-2Recombinant Human CD95 Proteins Ray Biotech20292 228-10206-2 Recombinant Human CD95 Proteins Ray Biotech 20 292€
ASK
Pub
228-11565-1Recombinant Troponin I-C (cardiac), 2nd Gen. Proteins Ray Biotech2147 228-11565-1 Recombinant Troponin I-C (cardiac), 2nd Gen. Proteins Ray Biotech 2 147€ Pub
228-10106-3Recombinant Human Bcl-XL Proteins Ray Biotech1mg0 228-10106-3 Recombinant Human Bcl-XL Proteins Ray Biotech 1mg 0€
ASK
Pub
228-11482-2Recombinant Human TARC CCL17 [+His] Proteins Ray Biotech10205 228-11482-2 Recombinant Human TARC CCL17 [+His] Proteins Ray Biotech 10 205€
ASK
Pub
228-10032-1Recombinant Human AGRP Proteins Ray Biotech2147 228-10032-1 Recombinant Human AGRP Proteins Ray Biotech 2 147€
ASK
Pub
228-11412-1Recombinant Human SCF KITLG Proteins Ray Biotech2147 228-11412-1 Recombinant Human SCF KITLG Proteins Ray Biotech 2 147€ Pub
Y105086G Protein Coupled Receptor GPR43 (FFAR2), Human ABM Goods50ug1174 Y105086 G Protein Coupled Receptor GPR43 (FFAR2), Human ABM Goods 50ug 1174€
ASK
Pub
DI0555PIK3R1 & HRAS Protein Protein Interaction Antibody PairAbnova1 Set765 DI0555 PIK3R1 & HRAS Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11334-2Recombinant Human PSMB1 Proteins Ray Biotech10205 228-11334-2 Recombinant Human PSMB1 Proteins Ray Biotech 10 205€
ASK
Pub
Y050528Anti DAPK3(Death associated protein kinase 3)ABM Goods100ug437 Y050528 Anti DAPK3(Death associated protein kinase 3) ABM Goods 100ug 437€
ASK
Pub
DI0389FLT1 & CRKL Protein Protein Interaction Antibody PairAbnova1 Set765 DI0389 FLT1 & CRKL Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11258-1Recombinant Human PKC epsilon [+His] [from Sf9] Proteins Ray Biotech2147 228-11258-1 Recombinant Human PKC epsilon [+His] [from Sf9] Proteins Ray Biotech 2 147€
ASK
Pub
228-11047-1Native Human LHRH Proteins Ray Biotech10mg147 228-11047-1 Native Human LHRH Proteins Ray Biotech 10mg 147€
ASK
Pub
MD-14-1216Rabbit Anti-WNV Envelope Protein Antibodies Ray Biotech100 452 MD-14-1216 Rabbit Anti-WNV Envelope Protein Antibodies Ray Biotech 100 452€
ASK
Pub
DI0225PRKCZ & GSK3B Protein Protein Interaction Antibody PairAbnova1 Set765 DI0225 PRKCZ & GSK3B Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11187-2Recombinant Human p38a SAPK2a Proteins Ray Biotech5485 228-11187-2 Recombinant Human p38a SAPK2a Proteins Ray Biotech 5 485€
ASK
Pub
228-10954-1Recombinant Human IL1R1 Proteins Ray Biotech2147 228-10954-1 Recombinant Human IL1R1 Proteins Ray Biotech 2 147€ Pub
M0532N (di Methyl amino naphthyl) N (para carboxy phenyl)hydrazide, NHS ester (MANCYL SE), Azo Dye Protein Labeling Reagent, 1mgMarkerGene249 M0532 N (di Methyl amino naphthyl) N (para carboxy phenyl)hydrazide, NHS ester (MANCYL SE), Azo Dye Protein Labeling Reagent, 1mg MarkerGene 249€
ASK
Pub
DI0061MAP3K5 & APP Protein Protein Interaction Antibody PairAbnova1 Set765 DI0061 MAP3K5 & APP Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-10868-3Recombinant Human IL-13 [+His] Proteins Ray Biotech1mg0 228-10868-3 Recombinant Human IL-13 [+His] Proteins Ray Biotech 1mg 0€
ASK
Pub
IHAPCi-0.1mgActivated Protein C Inactivate 0.1mgInnovative Research INC0.1mg559 IHAPCi-0.1mg Activated Protein C Inactivate 0.1mg Innovative Research INC 0.1mg 559€
ASK
Pub
bs-9920R-Cy3Rabbit Anti-G protein alpha Inhibitor 2 Polyclonal Antibody, Cy3 conjugated, Isotype: IgGSepax100ug Lyophilized268 bs-9920R-Cy3 Rabbit Anti-G protein alpha Inhibitor 2 Polyclonal Antibody, Cy3 conjugated, Isotype: IgG Sepax 100ug Lyophilized 268€ Pub
228-10788-3Recombinant Human HSP22 Proteins Ray Biotech1001312 228-10788-3 Recombinant Human HSP22 Proteins Ray Biotech 100 1312€
ASK
Pub
DP0227CAMK2A(phospho T286) & CAMK2A Protein Phosphorylation Antibody PairAbnova1 Set834 DP0227 CAMK2A(phospho T286) & CAMK2A Protein Phosphorylation Antibody Pair Abnova 1 Set 834€
ASK
Pub
bs-6840R-Cy3Rabbit Anti-IEX1 Differentiation dependent gene 2 protein Polyclonal Antibody, Cy3 conjugated, Isotype: IgGSepax100ug Lyophilized268 bs-6840R-Cy3 Rabbit Anti-IEX1 Differentiation dependent gene 2 protein Polyclonal Antibody, Cy3 conjugated, Isotype: IgG Sepax 100ug Lyophilized 268€ Pub
228-10725-3Recombinant HIV-1 gp41 [+His] Proteins Ray Biotech1000733 228-10725-3 Recombinant HIV-1 gp41 [+His] Proteins Ray Biotech 1000 733€
ASK
Pub
DP0054PRL(phospho S163) & PRL Protein Phosphorylation Antibody PairAbnova1 Set834 DP0054 PRL(phospho S163) & PRL Protein Phosphorylation Antibody Pair Abnova 1 Set 834€
ASK
Pub
bs-0761R-PE-Cy7Rabbit Anti-Midnolin isoform Protein 1 Polyclonal Antibody, PE-Cy7 ConjugatedBioss100ug401 bs-0761R-PE-Cy7 Rabbit Anti-Midnolin isoform Protein 1 Polyclonal Antibody, PE-Cy7 Conjugated Bioss 100ug 401€ Pub
228-10665-1Recombinant HCV NS4 a+b Proteins Ray Biotech100353 228-10665-1 Recombinant HCV NS4 a+b Proteins Ray Biotech 100 353€
ASK
Pub
bs-0033RRabbit Anti-P53 protein(wt-p53) Polyclonal AntibodySepax100ug Lyophilized222 bs-0033R Rabbit Anti-P53 protein(wt-p53) Polyclonal Antibody Sepax 100ug Lyophilized 222€
ASK
Pub
228-10593-3Recombinant Human GUCA2B Proteins Ray Biotech1mg0 228-10593-3 Recombinant Human GUCA2B Proteins Ray Biotech 1mg 0€ Pub
228-10521-2Recombinant Human GDF5 Proteins Ray Biotech50205 228-10521-2 Recombinant Human GDF5 Proteins Ray Biotech 50 205€
ASK
Pub
21332Niban like protein 1(Ab 712) antibody Host Species Rabbit polyclonalSignalWay Antibody S.A.B100 ug 197 21332 Niban like protein 1(Ab 712) antibody Host Species Rabbit polyclonal SignalWay Antibody S.A.B 100 ug 197€
ASK
Pub
228-10448-1Recombinant Human FGF1 FGF acidic Proteins Ray Biotech2147 228-10448-1 Recombinant Human FGF1 FGF acidic Proteins Ray Biotech 2 147€
ASK
Pub
rAP-0157-50TNF-a (Human) recombinant proteins AngoiPro50.00 ug279 rAP-0157-50 TNF-a (Human) recombinant proteins AngoiPro 50.00 ug 279€ Pub
MD-14-0034PNative Human Ferritin (Spleen) Proteins Ray Biotech1 mg257 MD-14-0034P Native Human Ferritin (Spleen) Proteins Ray Biotech 1 mg 257€ Pub
000704AUncoupling Protein 2ABM Goods250ul621 000704A Uncoupling Protein 2 ABM Goods 250ul 621€
ASK
Pub
228-10360-1Recombinant Human EGF Proteins Ray Biotech100147 228-10360-1 Recombinant Human EGF Proteins Ray Biotech 100 147€ Pub
rAP-0024-50FGF-2 (Bovine) recombinant proteins AngoiPro50.00 ug279 rAP-0024-50 FGF-2 (Bovine) recombinant proteins AngoiPro 50.00 ug 279€ Pub
IASMFBN-GF-HRPProteins and Antibodies Human and Animal Rabbit anti mouse fibronectin IgG fraction, HRP labeledInnovative Research INC1mg543 IASMFBN-GF-HRP Proteins and Antibodies Human and Animal Rabbit anti mouse fibronectin IgG fraction, HRP labeled Innovative Research INC 1mg 543€ Pub
230-00273-50 Proteins Ray Biotech50 229 230-00273-50 Proteins Ray Biotech 50 229€
ASK
Pub
230-00038-100Recombinant Human CKM [from E. coli] Proteins Ray Biotech100 318 230-00038-100 Recombinant Human CKM [from E. coli] Proteins Ray Biotech 100 318€ Pub
228-10238-1Recombinant Human c-jun AP1 [MBP-fusion] Proteins Ray Biotech2147 228-10238-1 Recombinant Human c-jun AP1 [MBP-fusion] Proteins Ray Biotech 2 147€ Pub
228-11605-3Recombinant Human VAMP2 Proteins Ray Biotech1mg2673 228-11605-3 Recombinant Human VAMP2 Proteins Ray Biotech 1mg 2673€
ASK
Pub
228-10132-1Recombinant Human BMP-5 Proteins Ray Biotech5147 228-10132-1 Recombinant Human BMP-5 Proteins Ray Biotech 5 147€
ASK
Pub
228-11519-2Recombinant Porcine TNF-alpha Proteins Ray Biotech20205 228-11519-2 Recombinant Porcine TNF-alpha Proteins Ray Biotech 20 205€ Pub
228-10060-1Recombinant Rat LRPAP1 Proteins Ray Biotech5147 228-10060-1 Recombinant Rat LRPAP1 Proteins Ray Biotech 5 147€
ASK
Pub
228-11438-3Recombinant Human SNAP23 Proteins Ray Biotech1mg2591 228-11438-3 Recombinant Human SNAP23 Proteins Ray Biotech 1mg 2591€
ASK
Pub
Y213499DEAD-box protein 6 AntibodyABM Goods200ul462 Y213499 DEAD-box protein 6 Antibody ABM Goods 200ul 462€
ASK
Pub
228-11358-3Recombinant Mouse RANTES CCL5 Proteins Ray Biotech1mg2426 228-11358-3 Recombinant Mouse RANTES CCL5 Proteins Ray Biotech 1mg 2426€ Pub
Y061655Anti-C-Reactive Protein produced in rabbit AntibodyABM Goods100ul994 Y061655 Anti-C-Reactive Protein produced in rabbit Antibody ABM Goods 100ul 994€
ASK
Pub
DI0454FAS & RHOA Protein Protein Interaction Antibody PairAbnova1 Set765 DI0454 FAS & RHOA Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11289-3Recombinant Human PPARG (aa 1-477) Proteins Ray Biotech10584 228-11289-3 Recombinant Human PPARG (aa 1-477) Proteins Ray Biotech 10 584€
ASK
Pub
228-11091-2Recombinant Measles Virus HA (aa 1-30,115-150,379-410) Proteins Ray Biotech500601 228-11091-2 Recombinant Measles Virus HA (aa 1-30,115-150,379-410) Proteins Ray Biotech 500 601€
ASK
Pub
RD172158100Human, Trefoil factor 1 (pS2 protein, PNR-2, TFF1) , Rec. Prot.Biovendor0.1 mg313 RD172158100 Human, Trefoil factor 1 (pS2 protein, PNR-2, TFF1) , Rec. Prot. Biovendor 0.1 mg 313€ Pub
DI0289AKT1 & FOXO3 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0289 AKT1 & FOXO3 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11219-2Recombinant Human PDPN Proteins Ray Biotech25205 228-11219-2 Recombinant Human PDPN Proteins Ray Biotech 25 205€
ASK
Pub
228-10987-2Recombinant Human KRT8 Proteins Ray Biotech5386 228-10987-2 Recombinant Human KRT8 Proteins Ray Biotech 5 386€
ASK
Pub
M24303563Alcohol dehydrogenase from Yeast, 300U mg protein CAS Number [9031 72 5]Molekula000 U228 M24303563 Alcohol dehydrogenase from Yeast, 300U mg protein CAS Number [9031 72 5] Molekula 000 U 228€
ASK
Pub
DI0128SYK & CTTN Protein Protein Interaction Antibody PairAbnova1 Set765 DI0128 SYK & CTTN Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-10907-2Recombinant Mouse IL-20 Proteins Ray Biotech10205 228-10907-2 Recombinant Mouse IL-20 Proteins Ray Biotech 10 205€ Pub
K-7250AccuRapid™ Cell Free Protein Expression KitBioneer24 reactions 694 K-7250 AccuRapid™ Cell Free Protein Expression Kit Bioneer 24 reactions 694€ Pub
Cat.1043-50Adar's Protein AAdar Biotech50 ml427 Cat.1043-50 Adar's Protein A Adar Biotech 50 ml 427€
ASK
Pub
228-10814-2Recombinant Human IFN-alpha Proteins Ray Biotech20205 228-10814-2 Recombinant Human IFN-alpha Proteins Ray Biotech 20 205€
ASK
Pub
DS-MB-01332Mouse Anti-Bovine Folate Binding Protein Antibodies Ray Biotech0.2 mg361 DS-MB-01332 Mouse Anti-Bovine Folate Binding Protein Antibodies Ray Biotech 0.2 mg 361€ Pub
bs-7556R-PE-Cy7Rabbit Anti-FLAP 5-lipoxygenase activating protein Polyclonal Antibody, PE-Cy7 conjugated Isotype: IgGSepax100ug Lyophilized300 bs-7556R-PE-Cy7 Rabbit Anti-FLAP 5-lipoxygenase activating protein Polyclonal Antibody, PE-Cy7 conjugated Isotype: IgG Sepax 100ug Lyophilized 300€ Pub
228-10747-1Recombinant HIV-1 TAT [+Biotin] Proteins Ray Biotech1147 228-10747-1 Recombinant HIV-1 TAT [+Biotin] Proteins Ray Biotech 1 147€ Pub
DP0120FLNA(phospho S2522) & FLNA Protein Phosphorylation Antibody PairAbnova1 Set834 DP0120 FLNA(phospho S2522) & FLNA Protein Phosphorylation Antibody Pair Abnova 1 Set 834€
ASK
Pub
bs-4626RRabbit Anti-HE4 Epididymal secretory protein E4 Polyclonal AntibodySepax100ug Lyophilized222 bs-4626R Rabbit Anti-HE4 Epididymal secretory protein E4 Polyclonal Antibody Sepax 100ug Lyophilized 222€ Pub
228-10687-2Recombinant HCV NS5 Genotype-5 Proteins Ray Biotech500601 228-10687-2 Recombinant HCV NS5 Genotype-5 Proteins Ray Biotech 500 601€
ASK
Pub
bs-0427R-HRPRabbit Anti-P311 protein Polyclonal Antibody, HRP ConjugatedBioss100ug369 bs-0427R-HRP Rabbit Anti-P311 protein Polyclonal Antibody, HRP Conjugated Bioss 100ug 369€
ASK
Pub
228-10620-1Recombinant HBx Proteins Ray Biotech5147 228-10620-1 Recombinant HBx Proteins Ray Biotech 5 147€
ASK
Pub
6527-1Protein A G Magnetic BeadsBiovision1 ml269 6527-1 Protein A G Magnetic Beads Biovision 1 ml 269€ Pub
228-10543-3Recombinant Human GHBP Proteins Ray Biotech1mg0 228-10543-3 Recombinant Human GHBP Proteins Ray Biotech 1mg 0€
ASK
Pub
228-11370-1Recombinant Human Regenerating Protein IVRay Biotech2 201 228-11370-1 Recombinant Human Regenerating Protein IV Ray Biotech 2 201€ Pub
228-10472-2Recombinant Human FHIT Proteins Ray Biotech5386 228-10472-2 Recombinant Human FHIT Proteins Ray Biotech 5 386€
ASK
Pub
rAP-0287-2sFGFR-3-Fc (rHuman) recombinant proteins AngoiPro2.00 ug133 rAP-0287-2 sFGFR-3-Fc (rHuman) recombinant proteins AngoiPro 2.00 ug 133€ Pub
MD-14-0272PRecombinant HEV ORF2 Proteins Ray Biotech100 386 MD-14-0272P Recombinant HEV ORF2 Proteins Ray Biotech 100 386€
ASK
Pub
02-300Lambda Protein PhosphataseB-Bridge20000 U154.875 02-300 Lambda Protein Phosphatase B-Bridge 20000 U 154.875€
ASK
Pub
228-10399-2Recombinant Human Eotaxin CCL11 Proteins Ray Biotech20205 228-10399-2 Recombinant Human Eotaxin CCL11 Proteins Ray Biotech 20 205€
ASK
Pub
rAP-0056-2BMP-7 (Human) recombinant proteins AngoiPro2.00 ug133 rAP-0056-2 BMP-7 (Human) recombinant proteins AngoiPro 2.00 ug 133€
ASK
Pub
ISASMZPIProteins and Antibodies Human and Animal Sheep anti mouse ZPI antiserumInnovative Research INC1ml543 ISASMZPI Proteins and Antibodies Human and Animal Sheep anti mouse ZPI antiserum Innovative Research INC 1ml 543€ Pub
228-10323-1Recombinant Human DFFA Proteins Ray Biotech5147 228-10323-1 Recombinant Human DFFA Proteins Ray Biotech 5 147€
ASK
Pub
MD-17-0053Mouse Anti-Troponin- I (Cardiac) Proteins Ray Biotech1 mg510 MD-17-0053 Mouse Anti-Troponin- I (Cardiac) Proteins Ray Biotech 1 mg 510€
ASK
Pub
DS-01-0049Recombinant Human CD71 Proteins Ray Biotech0.2 mg1101 DS-01-0049 Recombinant Human CD71 Proteins Ray Biotech 0.2 mg 1101€ Pub
230-00218-50Recombinant Human GOLM1 [from E. coli] Proteins Ray Biotech50 229 230-00218-50 Recombinant Human GOLM1 [from E. coli] Proteins Ray Biotech 50 229€ Pub
228-10261-2Recombinant Rat CNTF Proteins Ray Biotech25205 228-10261-2 Recombinant Rat CNTF Proteins Ray Biotech 25 205€
ASK
Pub
228-11628-3Recombinant Human VEGF VEGFA [from Yeast] Proteins Ray Biotech1mg0 228-11628-3 Recombinant Human VEGF VEGFA [from Yeast] Proteins Ray Biotech 1mg 0€
ASK
Pub
228-10161-2Recombinant Mouse Cal Proteins Ray Biotech5386 228-10161-2 Recombinant Mouse Cal Proteins Ray Biotech 5 386€
ASK
Pub
228-11548-3Recombinant Human TRAF2 Proteins Ray Biotech1mg2112 228-11548-3 Recombinant Human TRAF2 Proteins Ray Biotech 1mg 2112€
ASK
Pub
228-10095-1Recombinant Mouse BAX Proteins Ray Biotech2147 228-10095-1 Recombinant Mouse BAX Proteins Ray Biotech 2 147€
ASK
Pub
228-11471-2Streptavidin-NC Proteins Ray Biotech100318 228-11471-2 Streptavidin-NC Proteins Ray Biotech 100 318€ Pub
228-10018-3Native Human SERPINA3 Proteins Ray Biotech1mg510 228-10018-3 Native Human SERPINA3 Proteins Ray Biotech 1mg 510€
ASK
Pub
228-11401-2Recombinant SARS Virus Matrix Proteins Ray Biotech500601 228-11401-2 Recombinant SARS Virus Matrix Proteins Ray Biotech 500 601€
ASK
Pub
Y102903Adeno Associated Virus (AAV), Rep ProteinABM Goods50ug1168.65 Y102903 Adeno Associated Virus (AAV), Rep Protein ABM Goods 50ug 1168.65€
ASK
Pub
DI0520RICTOR & AKT1 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0520 RICTOR & AKT1 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11314-2Recombinant Mouse PRMT1 Proteins Ray Biotech50205 228-11314-2 Recombinant Mouse PRMT1 Proteins Ray Biotech 50 205€
ASK
Pub
228-11128-2Recombinant Human MMP13 Proteins Ray Biotech2.5353 228-11128-2 Recombinant Human MMP13 Proteins Ray Biotech 2.5 353€
ASK
Pub
Y050370Anti ATM Protein Kinase phospho ser1981 Biotin Conjugated ABM Goods100ug447.3 Y050370 Anti ATM Protein Kinase phospho ser1981 Biotin Conjugated ABM Goods 100ug 447.3€
ASK
Pub
DI0355MAPK3 & ATF2 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0355 MAPK3 & ATF2 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11247-2Recombinant Human PINX1 Proteins Ray Biotech20205 228-11247-2 Recombinant Human PINX1 Proteins Ray Biotech 20 205€
ASK
Pub
228-11031-1Recombinant Sheep Leptin (quad antagonist) Proteins Ray Biotech10147 228-11031-1 Recombinant Sheep Leptin (quad antagonist) Proteins Ray Biotech 10 147€
ASK
Pub
MD-14-0417Mouse Anti-Human LDL Receptor-Related Protein (LRP) Antibodies Ray Biotech100 223 MD-14-0417 Mouse Anti-Human LDL Receptor-Related Protein (LRP) Antibodies Ray Biotech 100 223€
ASK
Pub
DI0193WEE1 & FBXW11 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0193 WEE1 & FBXW11 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11170-2Recombinant Influenza HA (B Ohio 01 05) Proteins Ray Biotech10292 228-11170-2 Recombinant Influenza HA (B Ohio 01 05) Proteins Ray Biotech 10 292€ Pub
228-10935-1Recombinant Rat IL-5 Proteins Ray Biotech2147 228-10935-1 Recombinant Rat IL-5 Proteins Ray Biotech 2 147€ Pub
LF-P0071Glutathione Reductase, Yeast, ProteinAbfrontier0.5 mg218 LF-P0071 Glutathione Reductase, Yeast, Protein Abfrontier 0.5 mg 218€ Pub
DI0027MAPK14 & EGFR Protein Protein Interaction Antibody PairAbnova1 Set765 DI0027 MAPK14 & EGFR Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-10846-3Recombinant Human IL-1 alpha [+His] Proteins Ray Biotech1mg0 228-10846-3 Recombinant Human IL-1 alpha [+His] Proteins Ray Biotech 1mg 0€
ASK
Pub
ER-14-1512Goat Anti-Human Uncoupling protein 2 UCP2, (internal region) Antibodies Ray Biotech100 μg353 ER-14-1512 Goat Anti-Human Uncoupling protein 2 UCP2, (internal region) Antibodies Ray Biotech 100 μg 353€
ASK
Pub
bs-7605R-FITCRabbit Anti-Cell death inducing protein C16orf5 Polyclonal Antibody, FITC conjugated,Isotype: IgGSepax100ug Lyophilized304 bs-7605R-FITC Rabbit Anti-Cell death inducing protein C16orf5 Polyclonal Antibody, FITC conjugated,Isotype: IgG Sepax 100ug Lyophilized 304€ Pub
228-10769-3Recombinant Human HMOX1 Proteins Ray Biotech1mg1658 228-10769-3 Recombinant Human HMOX1 Proteins Ray Biotech 1mg 1658€ Pub
DP0192GRIN2B(phospho Y1472) & GRIN2B Protein Phosphorylation Antibody PairAbnova1 Set834 DP0192 GRIN2B(phospho Y1472) & GRIN2B Protein Phosphorylation Antibody Pair Abnova 1 Set 834€
ASK
Pub
bs-6792R-FITCRabbit Anti-APIP Apaf1 Interacting Protein Polyclonal Antibody, FITC conjugated,Isotype: IgGSepax100ug Lyophilized304 bs-6792R-FITC Rabbit Anti-APIP Apaf1 Interacting Protein Polyclonal Antibody, FITC conjugated,Isotype: IgG Sepax 100ug Lyophilized 304€ Pub
228-10713-2Recombinant HIV Type-O gp41 Proteins Ray Biotech500601 228-10713-2 Recombinant HIV Type-O gp41 Proteins Ray Biotech 500 601€
ASK
Pub
DP0012SMAD3(phospho S208) & SMAD3 Protein Phosphorylation Antibody PairAbnova1 Set834 DP0012 SMAD3(phospho S208) & SMAD3 Protein Phosphorylation Antibody Pair Abnova 1 Set 834€
ASK
Pub
bs-0760R-Cy3Rabbit Anti-Lpin1 protein Polyclonal Antibody, Cy3 ConjugatedBioss100ug369 bs-0760R-Cy3 Rabbit Anti-Lpin1 protein Polyclonal Antibody, Cy3 Conjugated Bioss 100ug 369€ Pub
228-10653-2Recombinant HCV NS3 Genotype-2c Proteins Ray Biotech500601 228-10653-2 Recombinant HCV NS3 Genotype-2c Proteins Ray Biotech 500 601€
ASK
Pub
AS09481BiP2 | luminal binding protein 2Agrisera100 ul393 AS09481 BiP2 | luminal binding protein 2 Agrisera 100 ul 393€
ASK
Pub
228-10578-2Recombinant Human HSP60 GroEL Proteins Ray Biotech20205 228-10578-2 Recombinant Human HSP60 GroEL Proteins Ray Biotech 20 205€
ASK
Pub
320126Protein,Treponema pallidum p47GenWay1 mg1046 320126 Protein,Treponema pallidum p47 GenWay 1 mg 1046€
ASK
Pub
228-10500-2Recombinant Human Fumarase Proteins Ray Biotech50205 228-10500-2 Recombinant Human Fumarase Proteins Ray Biotech 50 205€ Pub
128-10166-2Mouse Anti-SARS-Associated Coronavirus Nucleocapsid proteinRay Biotech200 1766 128-10166-2 Mouse Anti-SARS-Associated Coronavirus Nucleocapsid protein Ray Biotech 200 1766€
ASK
Pub
228-10432-3Recombinant Human FABP7 Proteins Ray Biotech1mg2591 228-10432-3 Recombinant Human FABP7 Proteins Ray Biotech 1mg 2591€
ASK
Pub
rAP-0089-2MIP-1a His-Tag (Human) recombinant proteins AngoiPro2.00 ug133 rAP-0089-2 MIP-1a His-Tag (Human) recombinant proteins AngoiPro 2.00 ug 133€ Pub
MD-05-0232Mouse Anti-HHV-6 gp60 110 Proteins Ray Biotech100 452 MD-05-0232 Mouse Anti-HHV-6 gp60 110 Proteins Ray Biotech 100 452€
ASK
Pub
ANA999 Alcian Blue Solution, pH 1.0 Scy tek 1000 ml 211 ANA999 Alcian Blue Solution, pH 1.0 Scy tek 1000 ml 211€
ASK
Pub
228-11631-3Recombinant Human VEGFR2 KDR [Fc-chimera] Proteins Ray Biotech1mg0 228-11631-3 Recombinant Human VEGFR2 KDR [Fc-chimera] Proteins Ray Biotech 1mg 0€
ASK
Pub
228-10164-3Recombinant Influenza HA (A Caledonia 20 99) Proteins Ray Biotech1001658 228-10164-3 Recombinant Influenza HA (A Caledonia 20 99) Proteins Ray Biotech 100 1658€ Pub
228-11551-3Recombinant T. pallidum p15 Proteins Ray Biotech10001244 228-11551-3 Recombinant T. pallidum p15 Proteins Ray Biotech 1000 1244€
ASK
Pub
228-10098-1Recombinant Human Bcl-2 -BH1 Proteins Ray Biotech2147 228-10098-1 Recombinant Human Bcl-2 -BH1 Proteins Ray Biotech 2 147€
ASK
Pub
228-11474-3Recombinant Human STX1A Proteins Ray Biotech1mg2426 228-11474-3 Recombinant Human STX1A Proteins Ray Biotech 1mg 2426€
ASK
Pub
228-10024-2Recombinant Human ACY1 Proteins Ray Biotech10205 228-10024-2 Recombinant Human ACY1 Proteins Ray Biotech 10 205€
ASK
Pub
228-11404-2Recombinant SARS Virus Nucleocapsid (aa 1-49) Proteins Ray Biotech500601 228-11404-2 Recombinant SARS Virus Nucleocapsid (aa 1-49) Proteins Ray Biotech 500 601€
ASK
Pub
Y103062C Reactive Protein (CRP)ABM Goods1 mg928 Y103062 C Reactive Protein (CRP) ABM Goods 1 mg 928€
ASK
Pub
DI0530IL1A & IL1R2 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0530 IL1A & IL1R2 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11318-1Recombinant Human CALCA [+His] Proteins Ray Biotech2147 228-11318-1 Recombinant Human CALCA [+His] Proteins Ray Biotech 2 147€ Pub
228-11132-2Recombinant Human MMP9 Proteins Ray Biotech10205 228-11132-2 Recombinant Human MMP9 Proteins Ray Biotech 10 205€ Pub
Y050439Anti-ATM Protein Kinase phospho-ser1981 for WB, IF and IP AntibodyABM Goods100ug396.9 Y050439 Anti-ATM Protein Kinase phospho-ser1981 for WB, IF and IP Antibody ABM Goods 100ug 396.9€
ASK
Pub
DI0364TP53 & HDAC1 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0364 TP53 & HDAC1 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11250-2Recombinant PKA holoenzyme, type 2 alpha Proteins Ray Biotech3485 228-11250-2 Recombinant PKA holoenzyme, type 2 alpha Proteins Ray Biotech 3 485€
ASK
Pub
228-11034-2Recombinant Rat Leptin (triple antagonist) Proteins Ray Biotech50205 228-11034-2 Recombinant Rat Leptin (triple antagonist) Proteins Ray Biotech 50 205€
ASK
Pub
MD-14-0569Rabbit Anti-Human Toll Interacting Protein TOLLIP Antibodies Ray Biotech100 502 MD-14-0569 Rabbit Anti-Human Toll Interacting Protein TOLLIP Antibodies Ray Biotech 100 502€
ASK
Pub
DI0202ICAM1 & FGG Protein Protein Interaction Antibody PairAbnova1 Set765 DI0202 ICAM1 & FGG Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11174-2Recombinant Human OPG TNFRSF11b (aa 2-201) [Fc-chimera] Proteins Ray Biotech50205 228-11174-2 Recombinant Human OPG TNFRSF11b (aa 2-201) [Fc-chimera] Proteins Ray Biotech 50 205€ Pub
228-10939-3Recombinant Rat IL-6 Proteins Ray Biotech1mg0 228-10939-3 Recombinant Rat IL-6 Proteins Ray Biotech 1mg 0€ Pub
M0065Fluorescein mono beta D Galactopyranoside, Highly fluorescent beta glucosidase probe, 10mgMarkerGene134 M0065 Fluorescein mono beta D Galactopyranoside, Highly fluorescent beta glucosidase probe, 10mg MarkerGene 134€
ASK
Pub
DI0037IL10 & A2M Protein Protein Interaction Antibody PairAbnova1 Set765 DI0037 IL10 & A2M Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-10851-2Recombinant Human IL-1 beta [+His] Proteins Ray Biotech20205 228-10851-2 Recombinant Human IL-1 beta [+His] Proteins Ray Biotech 20 205€ Pub
bs-7690R-PE-Cy3Rabbit Anti-P2RX4 ATP gated cation channel protein Polyclonal Antibody, PE-Cy3 Conjugated , 43kDa; Isotype IgG; Reactivity Human , Mouse , Rat , Bovine , Dog; Application Flow-Cyt(1 20-100), IF(1 5Bioss100ug Lyophilized530 bs-7690R-PE-Cy3 Rabbit Anti-P2RX4 ATP gated cation channel protein Polyclonal Antibody, PE-Cy3 Conjugated , 43kDa; Isotype IgG; Reactivity Human , Mouse , Rat , Bovine , Dog; Application Flow-Cyt(1 20-100), IF(1 5 Bioss 100ug Lyophilized 530€ Pub
228-10776-1Recombinant Human HPG1 Proteins Ray Biotech2147 228-10776-1 Recombinant Human HPG1 Proteins Ray Biotech 2 147€
ASK
Pub
DP0202CDKN1A(phospho T145) & CDKN1A Protein Phosphorylation Antibody PairAbnova1 Set834 DP0202 CDKN1A(phospho T145) & CDKN1A Protein Phosphorylation Antibody Pair Abnova 1 Set 834€
ASK
Pub
bs-6794R-A350Rabbit Anti-ANT-1 ATP carrier protein 1 Adenine Nucleotide Tra Polyclonal Antibody, Alexa Fluor 350 conjugated,Isotype: IgGSepax100ug Lyophilized323 bs-6794R-A350 Rabbit Anti-ANT-1 ATP carrier protein 1 Adenine Nucleotide Tra Polyclonal Antibody, Alexa Fluor 350 conjugated,Isotype: IgG Sepax 100ug Lyophilized 323€ Pub
228-10716-2Recombinant HIV-1 Envelope [+His] Proteins Ray Biotech500485 228-10716-2 Recombinant HIV-1 Envelope [+His] Proteins Ray Biotech 500 485€
ASK
Pub
DP0021NFKB1(phospho S337) & NFKB1 Protein Phosphorylation Antibody PairAbnova1 Set834 DP0021 NFKB1(phospho S337) & NFKB1 Protein Phosphorylation Antibody Pair Abnova 1 Set 834€
ASK
Pub
bs-0760R-HRPRabbit Anti-Lpin1 protein Polyclonal Antibody, HRP ConjugatedBioss100ug369 bs-0760R-HRP Rabbit Anti-Lpin1 protein Polyclonal Antibody, HRP Conjugated Bioss 100ug 369€ Pub
228-10656-2Recombinant HCV NS3 Genotype-5 Proteins Ray Biotech500601 228-10656-2 Recombinant HCV NS3 Genotype-5 Proteins Ray Biotech 500 601€
ASK
Pub
B0003-25 Protein Purification Beads Goat Anti-Rabbit IgG Beads (1-1.5mg ml)Boster biotechnology25ml 904.05 B0003-25 Protein Purification Beads Goat Anti-Rabbit IgG Beads (1-1.5mg ml) Boster biotechnology 25ml 904.05€
ASK
Pub
228-10582-2Recombinant E. coli HSP24 grpE Proteins Ray Biotech25205 228-10582-2 Recombinant E. coli HSP24 grpE Proteins Ray Biotech 25 205€ Pub
41-2005Blue biopsy cassettes, square cells, 500 pieces packBiologix1000 pieces/case126 41-2005 Blue biopsy cassettes, square cells, 500 pieces pack Biologix 1000 pieces/case 126€
ASK
Pub
228-10507-2Recombinant E, coli G6PD Proteins Ray Biotech50205 228-10507-2 Recombinant E, coli G6PD Proteins Ray Biotech 50 205€ Pub
13502Amplite™ Fluorimetric Caspase 3 7 Assay Kit *Blue Fluorescence*AAT Bioquest1 kit130 13502 Amplite™ Fluorimetric Caspase 3 7 Assay Kit *Blue Fluorescence* AAT Bioquest 1 kit 130€
ASK
Pub
228-10436-2Recombinant Human Factor VIII Proteins Ray Biotech500IU2261 228-10436-2 Recombinant Human Factor VIII Proteins Ray Biotech 500IU 2261€ Pub
rAP-0093b-20MIP-3b (Human) recombinant proteins AngoiPro20.00 ug279 rAP-0093b-20 MIP-3b (Human) recombinant proteins AngoiPro 20.00 ug 279€ Pub
MD-12-0015PNative Human IgM Proteins Ray Biotech5 mg188 MD-12-0015P Native Human IgM Proteins Ray Biotech 5 mg 188€ Pub
BCA999 Brilliant Cresyl Blue (0.3%, Alcoholic) Scy tek 1000 ml 139 BCA999 Brilliant Cresyl Blue (0.3%, Alcoholic) Scy tek 1000 ml 139€
ASK
Pub
228-10352-2Recombinant EBV EBNA1 [+His] Proteins Ray Biotech500832 228-10352-2 Recombinant EBV EBNA1 [+His] Proteins Ray Biotech 500 832€
ASK
Pub
rAP-0012-10VEGF-C (Rat) recombinant proteins AngoiPro10.00 ug279 rAP-0012-10 VEGF-C (Rat) recombinant proteins AngoiPro 10.00 ug 279€ Pub
DS-01-0499Recombinant Human BTC Proteins Ray Biotech20 452 DS-01-0499 Recombinant Human BTC Proteins Ray Biotech 20 452€
ASK
Pub
230-00249-10 Proteins Ray Biotech10 138 230-00249-10 Proteins Ray Biotech 10 138€
ASK
Pub
228-10291-3Recombinant Human CTLA4 CD152 Proteins Ray Biotech1mg0 228-10291-3 Recombinant Human CTLA4 CD152 Proteins Ray Biotech 1mg 0€
ASK
Pub
230-00007-WBCRecombinant Human MIF [from E. coli] Proteins Ray Biotech100 111 230-00007-WBC Recombinant Human MIF [from E. coli] Proteins Ray Biotech 100 111€ Pub
228-10225-1Recombinant T. cruzi Ag. Proteins Ray Biotech5240 228-10225-1 Recombinant T. cruzi Ag. Proteins Ray Biotech 5 240€
ASK
Pub
228-11588-1Recombinant Human UBE2L6 Proteins Ray Biotech5147 228-11588-1 Recombinant Human UBE2L6 Proteins Ray Biotech 5 147€
ASK
Pub
228-10122-2Recombinant Mouse BID Proteins Ray Biotech10205 228-10122-2 Recombinant Mouse BID Proteins Ray Biotech 10 205€
ASK
Pub
228-11501-3Recombinant Human TGFBR2 Proteins Ray Biotech1mg0 228-11501-3 Recombinant Human TGFBR2 Proteins Ray Biotech 1mg 0€
ASK
Pub
228-10046-3Native Bovine ALPI CIAP Proteins Ray Biotech35mg1244 228-10046-3 Native Bovine ALPI CIAP Proteins Ray Biotech 35mg 1244€ Pub
228-11427-3Recombinant Human SETD7 Proteins Ray Biotech1mg1031 228-11427-3 Recombinant Human SETD7 Proteins Ray Biotech 1mg 1031€
ASK
Pub
Y106033Amyloid Precursor Protein (APP) AntibodyABM Goods100ug327.6 Y106033 Amyloid Precursor Protein (APP) Antibody ABM Goods 100ug 327.6€
ASK
Pub
DI0597MAP3K14 & CASP3 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0597 MAP3K14 & CASP3 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11349-3Recombinant Human RAB5A Proteins Ray Biotech1mg0 228-11349-3 Recombinant Human RAB5A Proteins Ray Biotech 1mg 0€
ASK
Pub
Y059020Anti-mouse adenomatous polyposis coli protein (APC) AntibodyABM Goods100ug265.65 Y059020 Anti-mouse adenomatous polyposis coli protein (APC) Antibody ABM Goods 100ug 265.65€
ASK
Pub
DI0431PDGFRA & STAT3 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0431 PDGFRA & STAT3 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11278-3Recombinant Human Pleiotrophin Proteins Ray Biotech1mg0 228-11278-3 Recombinant Human Pleiotrophin Proteins Ray Biotech 1mg 0€
ASK
Pub
228-11077-3Recombinant Human MBL2 Proteins Ray Biotech1mg584 228-11077-3 Recombinant Human MBL2 Proteins Ray Biotech 1mg 584€
ASK
Pub
QCPR-500QuantiChrom™ Protein Assay KitBioassays500169 QCPR-500 QuantiChrom™ Protein Assay Kit Bioassays 500 169€ Pub
DI0266PDGFA & PDGFRA Protein Protein Interaction Antibody PairAbnova1 Set765 DI0266 PDGFA & PDGFRA Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11210-2Recombinant Human PDGF-AA Proteins Ray Biotech10205 228-11210-2 Recombinant Human PDGF-AA Proteins Ray Biotech 10 205€ Pub
228-10977-2Recombinant Human IRF4 MUM-1 Proteins Ray Biotech5386 228-10977-2 Recombinant Human IRF4 MUM-1 Proteins Ray Biotech 5 386€
ASK
Pub
M1214MarkerGeneTM Long Wavelength Fluorescent Lipase Assay Kit, Allows fast and easy measurement of lipase activity in vitro, in cell preparations or in vivo using the substrate resorufin oleate, 1 kitMarkerGene380 M1214 MarkerGeneTM Long Wavelength Fluorescent Lipase Assay Kit, Allows fast and easy measurement of lipase activity in vitro, in cell preparations or in vivo using the substrate resorufin oleate, 1 kit MarkerGene 380€ Pub
DI0104MAP3K7 & CLTC Protein Protein Interaction Antibody PairAbnova1 Set765 DI0104 MAP3K7 & CLTC Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-10897-1Recombinant Mouse IL-1ra ILIRN Proteins Ray Biotech5205 228-10897-1 Recombinant Mouse IL-1ra ILIRN Proteins Ray Biotech 5 205€
ASK
Pub
IR-RT-GF-50mgSprague Dawley Rat IgG Protein A Purified 50mgInnovative Research INC50mg559 IR-RT-GF-50mg Sprague Dawley Rat IgG Protein A Purified 50mg Innovative Research INC 50mg 559€ Pub
Cat.1017-1LAdar's protein G Sepharose Beads Adar Biotech1 l25592 Cat.1017-1L Adar's protein G Sepharose Beads Adar Biotech 1 l 25592€
ASK
Pub
228-10802-2Recombinant HTLV-1 gp21 Proteins Ray Biotech500601 228-10802-2 Recombinant HTLV-1 gp21 Proteins Ray Biotech 500 601€
ASK
Pub
DP0281KRT18(phospho S33) & KRT18 Protein Phosphorylation Antibody PairAbnova1 Set834 DP0281 KRT18(phospho S33) & KRT18 Protein Phosphorylation Antibody Pair Abnova 1 Set 834€
ASK
Pub
bs-6983R-Cy7Rabbit Anti-WT-1 Wilms Tumor Protein Polyclonal Antibody, Cy7 conjugated Isotype: IgGSepax100ug Lyophilized268 bs-6983R-Cy7 Rabbit Anti-WT-1 Wilms Tumor Protein Polyclonal Antibody, Cy7 conjugated Isotype: IgG Sepax 100ug Lyophilized 268€ Pub
228-10739-2Recombinant HIV-1 p24, 24kDa Proteins Ray Biotech10353 228-10739-2 Recombinant HIV-1 p24, 24kDa Proteins Ray Biotech 10 353€
ASK
Pub
DP0096TP53(phospho T55) & TP53 Protein Phosphorylation Antibody PairAbnova1 Set834 DP0096 TP53(phospho T55) & TP53 Protein Phosphorylation Antibody Pair Abnova 1 Set 834€
ASK
Pub
bs-2017R-PE-Cy3Rabbit Anti-14-3-3 family protein Polyclonal Antibody, PE-Cy3 ConjugatedBioss100ug401 bs-2017R-PE-Cy3 Rabbit Anti-14-3-3 family protein Polyclonal Antibody, PE-Cy3 Conjugated Bioss 100ug 401€ Pub
228-10679-3Recombinant HCV NS5 Genotype-1b Proteins Ray Biotech10001244 228-10679-3 Recombinant HCV NS5 Genotype-1b Proteins Ray Biotech 1000 1244€
ASK
Pub
bs-0419R-BiotinRabbit Anti-Tau protein Polyclonal Antibody, Biotin ConjugatedBioss100ug369 bs-0419R-Biotin Rabbit Anti-Tau protein Polyclonal Antibody, Biotin Conjugated Bioss 100ug 369€ Pub
228-10610-2Recombinant HBeAg Proteins Ray Biotech25205 228-10610-2 Recombinant HBeAg Proteins Ray Biotech 25 205€
ASK
Pub
6505-1LIsorbin (Fixed and killed S. aureus Protein A positive strain)1 LBiovision1 L1696 6505-1L Isorbin (Fixed and killed S. aureus Protein A positive strain)1 L Biovision 1 L 1696€
ASK
Pub
228-10536-1Recombinant Rabbit GH Proteins Ray Biotech10205 228-10536-1 Recombinant Rabbit GH Proteins Ray Biotech 10 205€
ASK
Pub
22673amyloid beta precursor protein-binding family B member 3 isoform a antibody Source Rabbit Polyconal Ab Species Human Application WBSignalWay Antibody S.A.B 100ul329 22673 amyloid beta precursor protein-binding family B member 3 isoform a antibody Source Rabbit Polyconal Ab Species Human Application WB SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
228-10463-3Recombinant Human FGF9 Proteins Ray Biotech1mg0 228-10463-3 Recombinant Human FGF9 Proteins Ray Biotech 1mg 0€ Pub
rAP-0276-10sVEGFR-1 sFlt-1 D3 (rHuman) recombinant proteins AngoiPro10.00 ug279 rAP-0276-10 sVEGFR-1 sFlt-1 D3 (rHuman) recombinant proteins AngoiPro 10.00 ug 279€ Pub
MD-14-0230PRecombinant HBV HBsAg, ay Proteins Ray Biotech100 502 MD-14-0230P Recombinant HBV HBsAg, ay Proteins Ray Biotech 100 502€
ASK
Pub
010-14531Anti C Reactive Protein Anti Human C Reactive Protein (CRP) monoclonal antibody is produced by hybridoma clone 409 being established by fusing myeloma cells NS 1 and spleen cells of BALB c mice which B-Bridge1mg800.1 010-14531 Anti C Reactive Protein Anti Human C Reactive Protein (CRP) monoclonal antibody is produced by hybridoma clone 409 being established by fusing myeloma cells NS 1 and spleen cells of BALB c mice which B-Bridge 1mg 800.1€
ASK
Pub
228-10378-2Recombinant Tick-Borne Encephalitis Core Proteins Ray Biotech500601 228-10378-2 Recombinant Tick-Borne Encephalitis Core Proteins Ray Biotech 500 601€
ASK
Pub
rAP-0045-10IGF-1 (Mouse) recombinant proteins AngoiPro10.00 ug133 rAP-0045-10 IGF-1 (Mouse) recombinant proteins AngoiPro 10.00 ug 133€ Pub
IMA-7F1-FITCProteins and Antibodies Human and Animal Mouse Monoclonal to Human RAP, Fluorescein LabeledInnovative Research INC1mg3123 IMA-7F1-FITC Proteins and Antibodies Human and Animal Mouse Monoclonal to Human RAP, Fluorescein Labeled Innovative Research INC 1mg 3123€ Pub
228-10307-1Recombinant Human DDIT3 Proteins Ray Biotech5205 228-10307-1 Recombinant Human DDIT3 Proteins Ray Biotech 5 205€
ASK
Pub
MD-14-0906Mouse Anti-IL-2R Proteins Ray Biotech200 257 MD-14-0906 Mouse Anti-IL-2R Proteins Ray Biotech 200 257€
ASK
Pub
AA0023EGF Phospho-Specific Array includes 214 highly specific and well-characterized phosphorylation antibodies related to the EGF family of proteins.Abnova2 Pieces/Box822 AA0023 EGF Phospho-Specific Array includes 214 highly specific and well-characterized phosphorylation antibodies related to the EGF family of proteins. Abnova 2 Pieces/Box 822€
ASK
Pub
230-00208-10Recombinant Human IGFBP-1 [from E. coli] Proteins Ray Biotech10 138 230-00208-10 Recombinant Human IGFBP-1 [from E. coli] Proteins Ray Biotech 10 138€ Pub
228-10252-2Recombinant Mouse CLU ApoJ Proteins Ray Biotech20240 228-10252-2 Recombinant Mouse CLU ApoJ Proteins Ray Biotech 20 240€
ASK
Pub
228-11621-1Recombinant Human VEGF-C Proteins Ray Biotech2147 228-11621-1 Recombinant Human VEGF-C Proteins Ray Biotech 2 147€
ASK
Pub
228-10151-2Recombinant Human C1QTNF1 Proteins Ray Biotech10205 228-10151-2 Recombinant Human C1QTNF1 Proteins Ray Biotech 10 205€
ASK
Pub
228-11536-2Recombinant T. gondii p24 Proteins Ray Biotech500601 228-11536-2 Recombinant T. gondii p24 Proteins Ray Biotech 500 601€
ASK
Pub
228-10084-1Native Human APOH B2GPI Proteins Ray Biotech100147 228-10084-1 Native Human APOH B2GPI Proteins Ray Biotech 100 147€
ASK
Pub
228-11461-1Staphylokinase Proteins Ray Biotech20147 228-11461-1 Staphylokinase Proteins Ray Biotech 20 147€ Pub
228-10005-2Recombinant Human SERPINA1 Proteins Ray Biotech25205 228-10005-2 Recombinant Human SERPINA1 Proteins Ray Biotech 25 205€ Pub
228-11383-2Recombinant Human RO-60 Proteins Ray Biotech50205 228-11383-2 Recombinant Human RO-60 Proteins Ray Biotech 50 205€
ASK
Pub
Y090639Anti-Dally-like protein (Dlp) Monoclonal AntibodyABM Goods100ul265 Y090639 Anti-Dally-like protein (Dlp) Monoclonal Antibody ABM Goods 100ul 265€
ASK
Pub
DI0496MAP3K7 & MAP3K7IP1 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0496 MAP3K7 & MAP3K7IP1 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11306-1Recombinant PRKACA Proteins Ray Biotech1147 228-11306-1 Recombinant PRKACA Proteins Ray Biotech 1 147€ Pub
228-11119-2Recombinant Human MIP-3 beta CCL19 Proteins Ray Biotech20205 228-11119-2 Recombinant Human MIP-3 beta CCL19 Proteins Ray Biotech 20 205€
ASK
Pub
SA-8851-15FITC conj anti rat IgG (H+L), goat anti MXR B,H,Hu&Rb ser. proteinImmunoBioscience1 mg193 SA-8851-15 FITC conj anti rat IgG (H+L), goat anti MXR B,H,Hu&Rb ser. protein ImmunoBioscience 1 mg 193€ Pub
DI0332BIRC5 & CASP9 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0332 BIRC5 & CASP9 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11236-3Recombinant Human PGP9.5 Proteins Ray Biotech10584 228-11236-3 Recombinant Human PGP9.5 Proteins Ray Biotech 10 584€
ASK
Pub
228-11012-2Recombinant Mouse LBP Proteins Ray Biotech5386 228-11012-2 Recombinant Mouse LBP Proteins Ray Biotech 5 386€ Pub
MD-05-0428Rabbit Anti-SARS-CoV M Protein (C-term) Antibodies Ray Biotech100 452 MD-05-0428 Rabbit Anti-SARS-CoV M Protein (C-term) Antibodies Ray Biotech 100 452€
ASK
Pub
DI0170FADD & EZR Protein Protein Interaction Antibody PairAbnova1 Set765 DI0170 FADD & EZR Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11159-2Recombinant Human NMM Proteins Ray Biotech10205 228-11159-2 Recombinant Human NMM Proteins Ray Biotech 10 205€
ASK
Pub
228-10925-3Recombinant Human IL-33 Proteins Ray Biotech1mg0 228-10925-3 Recombinant Human IL-33 Proteins Ray Biotech 1mg 0€
ASK
Pub
LF-P0002Peroxiredoxin I, Human, ProteinAbfrontier0.25 mg298 LF-P0002 Peroxiredoxin I, Human, Protein Abfrontier 0.25 mg 298€ Pub
DI0002CRKL & SOS1 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0002 CRKL & SOS1 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-10835-1Recombinant Human IGF1, Des (1-3) Proteins Ray Biotech20147 228-10835-1 Recombinant Human IGF1, Des (1-3) Proteins Ray Biotech 20 147€ Pub
E0471hHuman Osteocalcin Bone gla protein ELISA KitEIAab96T789 E0471h Human Osteocalcin Bone gla protein ELISA Kit EIAab 96T 789€ Pub
bs-7575R-A647Rabbit Anti-SEC14 like protein 2 Squalene transfer protein Polyclonal Antibody, Alexa Fluor 647 conjugated,Isotype: IgGSepax100ug Lyophilized323 bs-7575R-A647 Rabbit Anti-SEC14 like protein 2 Squalene transfer protein Polyclonal Antibody, Alexa Fluor 647 conjugated,Isotype: IgG Sepax 100ug Lyophilized 323€ Pub
228-10760-3Recombinant HIV-2 gp36 (aa 390-702) Proteins Ray Biotech10001244 228-10760-3 Recombinant HIV-2 gp36 (aa 390-702) Proteins Ray Biotech 1000 1244€
ASK
Pub
DP0166PLCG1(phospho Y783) & PLCG1 Protein Phosphorylation Antibody PairAbnova1 Set834 DP0166 PLCG1(phospho Y783) & PLCG1 Protein Phosphorylation Antibody Pair Abnova 1 Set 834€
ASK
Pub
bs-6789R-BiotinRabbit Anti-SRGN Chondroitin sulfate proteoglycan core protein Polyclonal Antibody, Biotin conjugated, Isotype: IgGSepax100ug Lyophilized268 bs-6789R-Biotin Rabbit Anti-SRGN Chondroitin sulfate proteoglycan core protein Polyclonal Antibody, Biotin conjugated, Isotype: IgG Sepax 100ug Lyophilized 268€ Pub
228-10704-1Recombinant Human HGF [from CHO cells] Proteins Ray Biotech2147 228-10704-1 Recombinant Human HGF [from CHO cells] Proteins Ray Biotech 2 147€ Pub
DI0612DKK1 & CTNNB1 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0612 DKK1 & CTNNB1 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
bs-0759R-A350Rabbit Anti-Lpin1 protein Polyclonal Antibody, Alexa Fluor 350 conjugated,Isotype: IgGSepax100ug Lyophilized323 bs-0759R-A350 Rabbit Anti-Lpin1 protein Polyclonal Antibody, Alexa Fluor 350 conjugated,Isotype: IgG Sepax 100ug Lyophilized 323€ Pub
228-10644-3Recombinant HCV NS3 Genotype-1a Proteins Ray Biotech10001244 228-10644-3 Recombinant HCV NS3 Genotype-1a Proteins Ray Biotech 1000 1244€
ASK
Pub
90256-2Noggin Active Human Recombinant ProteinBPS Bioscience50 µg363 90256-2 Noggin Active Human Recombinant Protein BPS Bioscience 50 µg 363€
ASK
Pub
228-10561-3Recombinant Human GNMT Proteins Ray Biotech1mg1658 228-10561-3 Recombinant Human GNMT Proteins Ray Biotech 1mg 1658€
ASK
Pub
23147MID1 interacting G12-like protein antibody Source Rabbit Polyconal Ab Species Human Application WB IHC IFSignalWay Antibody S.A.B 100ul329 23147 MID1 interacting G12-like protein antibody Source Rabbit Polyconal Ab Species Human Application WB IHC IF SignalWay Antibody S.A.B 100ul 329€
ASK
Pub
228-10489-1Recombinant Human Flt3 Ligand Proteins Ray Biotech2147 228-10489-1 Recombinant Human Flt3 Ligand Proteins Ray Biotech 2 147€
ASK
Pub
Y060504Anti Acetylated Proteins produced in rabbitABM Goods100ul964.95 Y060504 Anti Acetylated Proteins produced in rabbit ABM Goods 100ul 964.95€
ASK
Pub
MD-14-0391PRecombinant HCV NS-5 Genotype 1 Proteins Ray Biotech1 mg1031 MD-14-0391P Recombinant HCV NS-5 Genotype 1 Proteins Ray Biotech 1 mg 1031€
ASK
Pub
1107ReadiLink™ mFluor™ Violet 420 Protein Labeling Kit *Bulk Scale Optimized for Labeling 10 mg Protein Per Reaction*AAT Bioquest1 kit376 1107 ReadiLink™ mFluor™ Violet 420 Protein Labeling Kit *Bulk Scale Optimized for Labeling 10 mg Protein Per Reaction* AAT Bioquest 1 kit 376€
ASK
Pub
228-10425-1Recombinant Human FABP3 Proteins Ray Biotech5147 228-10425-1 Recombinant Human FABP3 Proteins Ray Biotech 5 147€ Pub
rAP-0078-10SCF (Human) recombinant proteins AngoiPro10.00 ug279 rAP-0078-10 SCF (Human) recombinant proteins AngoiPro 10.00 ug 279€ Pub
MD-05-0086PHIV-1 env Ag conj. to gp36 Proteins Ray Biotech1 mg1101 MD-05-0086P HIV-1 env Ag conj. to gp36 Proteins Ray Biotech 1 mg 1101€ Pub
8M79 Myelin Basic Protein ACR 1 mg 388 8M79 Myelin Basic Protein ACR 1 mg 388€ Pub
228-10337-3Recombinant Human DNase Proteins Ray Biotech10,000IU601 228-10337-3 Recombinant Human DNase Proteins Ray Biotech 10,000IU 601€
ASK
Pub
MD-27-0014PNative Bovine Sm RNP Antigen Proteins Ray Biotech200 223 MD-27-0014P Native Bovine Sm RNP Antigen Proteins Ray Biotech 200 223€
ASK
Pub
DS-01-0307Recombinant Mouse MCP-5 CCL12 Proteins Ray Biotech20 452 DS-01-0307 Recombinant Mouse MCP-5 CCL12 Proteins Ray Biotech 20 452€
ASK
Pub
230-00236-50Recombinant Human CD57 B3GAT1 [from E. coli] Proteins Ray Biotech50 229 230-00236-50 Recombinant Human CD57 B3GAT1 [from E. coli] Proteins Ray Biotech 50 229€ Pub
228-10280-2Recombinant Human CRYAA Proteins Ray Biotech100205 228-10280-2 Recombinant Human CRYAA Proteins Ray Biotech 100 205€
ASK
Pub
228-11651-3Rrecombinant Influenza HA (A Wyoming 3 03) Proteins Ray Biotech1001658 228-11651-3 Rrecombinant Influenza HA (A Wyoming 3 03) Proteins Ray Biotech 100 1658€
ASK
Pub
228-10211-2Recombinant Human CDK4 Proteins Ray Biotech10205 228-10211-2 Recombinant Human CDK4 Proteins Ray Biotech 10 205€
ASK
Pub
228-11574-1Recombinant Human TSLP Proteins Ray Biotech5147 228-11574-1 Recombinant Human TSLP Proteins Ray Biotech 5 147€
ASK
Pub
228-10109-3Recombinant Human DEFB2 Proteins Ray Biotech1mg2426 228-10109-3 Recombinant Human DEFB2 Proteins Ray Biotech 1mg 2426€
ASK
Pub
228-11485-2Recombinant Human TCEB2 Proteins Ray Biotech50205 228-11485-2 Recombinant Human TCEB2 Proteins Ray Biotech 50 205€
ASK
Pub
228-10036-1Recombinant Human GITRL TNFSF18 Proteins Ray Biotech5147 228-10036-1 Recombinant Human GITRL TNFSF18 Proteins Ray Biotech 5 147€ Pub
228-11415-2Recombinant Rat SCGN Proteins Ray Biotech10205 228-11415-2 Recombinant Rat SCGN Proteins Ray Biotech 10 205€
ASK
Pub
Y105143G Protein Coupled Receptor G2A (GPR132), Human ABM Goods50ug1174 Y105143 G Protein Coupled Receptor G2A (GPR132), Human ABM Goods 50ug 1174€
ASK
Pub
DI0564KLK3 & FN1 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0564 KLK3 & FN1 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11337-2Recombinant Human PSPH Proteins Ray Biotech20292 228-11337-2 Recombinant Human PSPH Proteins Ray Biotech 20 292€ Pub
Y050775Anti-DAM1(Kinetochore assembly protein DAM1) AntibodyABM Goods100ug386 Y050775 Anti-DAM1(Kinetochore assembly protein DAM1) Antibody ABM Goods 100ug 386€
ASK
Pub
DI0398PTK2 & YES1 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0398 PTK2 & YES1 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11261-1Recombinant Human PKM2 Proteins Ray Biotech2147 228-11261-1 Recombinant Human PKM2 Proteins Ray Biotech 2 147€ Pub
228-11061-3Recombinant Human LYVE1 Proteins Ray Biotech10584 228-11061-3 Recombinant Human LYVE1 Proteins Ray Biotech 10 584€
ASK
Pub
MT-104-11Mouse Embryo E11 Total ProteinZyagen0.5mg222.6 MT-104-11 Mouse Embryo E11 Total Protein Zyagen 0.5mg 222.6€ Pub
DI0234PRKCD & GRM5 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0234 PRKCD & GRM5 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11193-2Recombinant Human tPA PLAT Proteins Ray Biotech100275 228-11193-2 Recombinant Human tPA PLAT Proteins Ray Biotech 100 275€
ASK
Pub
228-10957-1Recombinant Influenza HA (A Indonesia 05 05) Proteins Ray Biotech2147 228-10957-1 Recombinant Influenza HA (A Indonesia 05 05) Proteins Ray Biotech 2 147€ Pub
M06372 Chloro 4 nitrophenyl beta D cellobioside, Fluorescent Substrate for Cellulases, 25mgMarkerGene134 M0637 2 Chloro 4 nitrophenyl beta D cellobioside, Fluorescent Substrate for Cellulases, 25mg MarkerGene 134€
ASK
Pub
DI0071BID & BAX Protein Protein Interaction Antibody PairAbnova1 Set765 DI0071 BID & BAX Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-10873-3Recombinant Human IL-15 [+His] Proteins Ray Biotech1mg0 228-10873-3 Recombinant Human IL-15 [+His] Proteins Ray Biotech 1mg 0€
ASK
Pub
IMA-HPS-2Proteins and Antibodies Human and Animal Anti-Human Protein SInnovative Research INC0.1mg421 IMA-HPS-2 Proteins and Antibodies Human and Animal Anti-Human Protein S Innovative Research INC 0.1mg 421€
ASK
Pub
bs-9920R-PE-Cy7Rabbit Anti-G protein alpha Inhibitor 2 Polyclonal Antibody, PE-Cy7 conjugated Isotype: IgGSepax100ug Lyophilized300 bs-9920R-PE-Cy7 Rabbit Anti-G protein alpha Inhibitor 2 Polyclonal Antibody, PE-Cy7 conjugated Isotype: IgG Sepax 100ug Lyophilized 300€ Pub
228-10791-3Recombinant M. tuberculosis HSP65 Proteins Ray Biotech1001312 228-10791-3 Recombinant M. tuberculosis HSP65 Proteins Ray Biotech 100 1312€ Pub
DP0242SMAD3(phospho S425) & SMAD3 Protein Phosphorylation Antibody PairAbnova1 Set834 DP0242 SMAD3(phospho S425) & SMAD3 Protein Phosphorylation Antibody Pair Abnova 1 Set 834€
ASK
Pub
bs-6840R-PE-Cy5Rabbit Anti-IEX1 Differentiation dependent gene 2 protein Polyclonal Antibody, PE-Cy5 conjugated Isotype: IgGSepax100ug Lyophilized300 bs-6840R-PE-Cy5 Rabbit Anti-IEX1 Differentiation dependent gene 2 protein Polyclonal Antibody, PE-Cy5 conjugated Isotype: IgG Sepax 100ug Lyophilized 300€ Pub
228-10728-3Recombinant HIV-1 gp41 Long [+HRP] Proteins Ray Biotech10001452 228-10728-3 Recombinant HIV-1 gp41 Long [+HRP] Proteins Ray Biotech 1000 1452€
ASK
Pub
DP0063KDR(phospho Y951) & KDR Protein Phosphorylation Antibody PairAbnova1 Set834 DP0063 KDR(phospho Y951) & KDR Protein Phosphorylation Antibody Pair Abnova 1 Set 834€
ASK
Pub
bs-1265M-PERabbit Anti-F1 protein (YERSINIA PESTIS) Monoclonal Antibody, PE ConjugatedBioss100ug369 bs-1265M-PE Rabbit Anti-F1 protein (YERSINIA PESTIS) Monoclonal Antibody, PE Conjugated Bioss 100ug 369€
ASK
Pub
228-10668-1Recombinant HCV NS4 Genotype-1 Proteins Ray Biotech100240 228-10668-1 Recombinant HCV NS4 Genotype-1 Proteins Ray Biotech 100 240€
ASK
Pub
bs-0033R-Cy7Rabbit Anti-P53 protein(wt-p53) Polyclonal Antibody, Cy7 ConjugatedBioss100ug369 bs-0033R-Cy7 Rabbit Anti-P53 protein(wt-p53) Polyclonal Antibody, Cy7 Conjugated Bioss 100ug 369€
ASK
Pub
228-10598-3Recombinant HAV P2C-P3A Proteins Ray Biotech10001031 228-10598-3 Recombinant HAV P2C-P3A Proteins Ray Biotech 1000 1031€
ASK
Pub
5510-100Protein G AntibodyBiovision100 281 5510-100 Protein G Antibody Biovision 100 281€
ASK
Pub
228-10525-2Native Bovine GFP Proteins Ray Biotech10205 228-10525-2 Native Bovine GFP Proteins Ray Biotech 10 205€ Pub
22006Calcein blue *UltraPure Grade*AAT Bioquest25 mg108 22006 Calcein blue *UltraPure Grade* AAT Bioquest 25 mg 108€
ASK
Pub
228-10451-1Recombinant Bovine bFGF FGF basic FGF2 Proteins Ray Biotech10147 228-10451-1 Recombinant Bovine bFGF FGF basic FGF2 Proteins Ray Biotech 10 147€ Pub
rAP-0162-20TNF-a (Porcine) recombinant proteins AngoiPro20.00 ug279 rAP-0162-20 TNF-a (Porcine) recombinant proteins AngoiPro 20.00 ug 279€ Pub
MD-14-0049PNative Human LDH3 Proteins Ray Biotech100 Units353 MD-14-0049P Native Human LDH3 Proteins Ray Biotech 100 Units 353€
ASK
Pub
000762AProtein Phosphatase 1 subunit GM (delta C)ABM Goods250ul621 000762A Protein Phosphatase 1 subunit GM (delta C) ABM Goods 250ul 621€
ASK
Pub
228-10363-1Native Rat EGF Proteins Ray Biotech2147 228-10363-1 Native Rat EGF Proteins Ray Biotech 2 147€
ASK
Pub
rAP-0029-25FGF-19 (Human) recombinant proteins AngoiPro25.00 ug279 rAP-0029-25 FGF-19 (Human) recombinant proteins AngoiPro 25.00 ug 279€ Pub
IASMVN-GF-BIOProteins and Antibodies Human and Animal Rabbit anti mouse Vitronectin IgG fraction, biotin labeledInnovative Research INC1mg789 IASMVN-GF-BIO Proteins and Antibodies Human and Animal Rabbit anti mouse Vitronectin IgG fraction, biotin labeled Innovative Research INC 1mg 789€ Pub
230-00501-50 Proteins Ray Biotech50 229 230-00501-50 Proteins Ray Biotech 50 229€
ASK
Pub
230-00042-100Recombinant Human GPBB PYGB [from E. coli] Proteins Ray Biotech100 318 230-00042-100 Recombinant Human GPBB PYGB [from E. coli] Proteins Ray Biotech 100 318€ Pub
228-10241-1Recombinant Human CK2h Proteins Ray Biotech3147 228-10241-1 Recombinant Human CK2h Proteins Ray Biotech 3 147€
ASK
Pub
228-11608-3Recombinant Human VAMP5 Proteins Ray Biotech1mg0 228-11608-3 Recombinant Human VAMP5 Proteins Ray Biotech 1mg 0€
ASK
Pub
228-10136-2Recombinant Human BMP-7 Proteins Ray Biotech50205 228-10136-2 Recombinant Human BMP-7 Proteins Ray Biotech 50 205€ Pub
228-11522-2Recombinant Human TNF-alpha [+His] Proteins Ray Biotech50205 228-11522-2 Recombinant Human TNF-alpha [+His] Proteins Ray Biotech 50 205€ Pub
228-10064-1Recombinant Human APCS Proteins Ray Biotech2147 228-10064-1 Recombinant Human APCS Proteins Ray Biotech 2 147€
ASK
Pub
228-11441-3Recombinant Human SNAP25B Proteins Ray Biotech1mg2591 228-11441-3 Recombinant Human SNAP25B Proteins Ray Biotech 1mg 2591€
ASK
Pub
3544-100Proteinase Inhibitor 9 (PI9) mAb100 ugBiovision100 ug325.08 3544-100 Proteinase Inhibitor 9 (PI9) mAb100 ug Biovision 100 ug 325.08€
ASK
Pub
228-11361-3Recombinant RAR alpha Proteins Ray Biotech1mg2426 228-11361-3 Recombinant RAR alpha Proteins Ray Biotech 1mg 2426€ Pub
Y061806Monoclonal Anti Bone Morphogenetic Protein 8 produced in mouseABM Goods100ug965 Y061806 Monoclonal Anti Bone Morphogenetic Protein 8 produced in mouse ABM Goods 100ug 965€
ASK
Pub
DI0463MAX & MSH2 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0463 MAX & MSH2 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11292-3Recombinant Human PPIL1 Proteins Ray Biotech1mg1658 228-11292-3 Recombinant Human PPIL1 Proteins Ray Biotech 1mg 1658€
ASK
Pub
228-11098-2Native Human MG Proteins Ray Biotech5mg353 228-11098-2 Native Human MG Proteins Ray Biotech 5mg 353€
ASK
Pub
RD181073100-01Rabbit Polyclonal Antibody; Angiopoietin-like Protein 4, Anti-HumanBiovendor0.1 mg258 RD181073100-01 Rabbit Polyclonal Antibody; Angiopoietin-like Protein 4, Anti-Human Biovendor 0.1 mg 258€ Pub
DI0300GSK3B & IKBKG Protein Protein Interaction Antibody PairAbnova1 Set765 DI0300 GSK3B & IKBKG Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11223-2Recombinant Human PEDF [+His] Proteins Ray Biotech20353 228-11223-2 Recombinant Human PEDF [+His] Proteins Ray Biotech 20 353€ Pub
228-10991-3Recombinant Human KIR2DL1 Proteins Ray Biotech1mg0 228-10991-3 Recombinant Human KIR2DL1 Proteins Ray Biotech 1mg 0€
ASK
Pub
M59224569MTT (Thiazolyl blue tetrazolium bromide) CAS Number [298 93 1]Molekula 5 G290 M59224569 MTT (Thiazolyl blue tetrazolium bromide) CAS Number [298 93 1] Molekula 5 G 290€
ASK
Pub
DI0137FYN & CTLA4 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0137 FYN & CTLA4 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11144-3Recombinant Human MSTN FGF8 Proteins Ray Biotech1mg0 228-11144-3 Recombinant Human MSTN FGF8 Proteins Ray Biotech 1mg 0€
ASK
Pub
228-10910-2Recombinant Mouse IL-22 Proteins Ray Biotech10205 228-10910-2 Recombinant Mouse IL-22 Proteins Ray Biotech 10 205€
ASK
Pub
K007-F1Palladium PdX™ API Fluorescent KitArbor Assays1x96 well plate575 K007-F1 Palladium PdX™ API Fluorescent Kit Arbor Assays 1x96 well plate 575€
ASK
Pub
Cat.6028-50Blue BeadsAdar Biotech50 ml442 Cat.6028-50 Blue Beads Adar Biotech 50 ml 442€
ASK
Pub
228-10819-2Recombinant Human IFN-alpha 2b Proteins Ray Biotech100205 228-10819-2 Recombinant Human IFN-alpha 2b Proteins Ray Biotech 100 205€ Pub
DS-MB-02219Mouse Anti-RSV Fusion Protein Antibodies Ray Biotech0.1 mg535 DS-MB-02219 Mouse Anti-RSV Fusion Protein Antibodies Ray Biotech 0.1 mg 535€
ASK
Pub
bs-7563R-Cy5.5Rabbit Anti-TNIP2 ABIN2 TNFAIP3 interacting protein 2 Polyclonal Antibody, Cy5.5 conjugated, Isotype: IgGSepax100ug Lyophilized268 bs-7563R-Cy5.5 Rabbit Anti-TNIP2 ABIN2 TNFAIP3 interacting protein 2 Polyclonal Antibody, Cy5.5 conjugated, Isotype: IgG Sepax 100ug Lyophilized 268€
ASK
Pub
228-10750-1Recombinant HIV-1 TAT Clade-C Proteins Ray Biotech2147 228-10750-1 Recombinant HIV-1 TAT Clade-C Proteins Ray Biotech 2 147€
ASK
Pub
DP0132RELA(phospho T435) & RELA Protein Phosphorylation Antibody PairAbnova1 Set834 DP0132 RELA(phospho T435) & RELA Protein Phosphorylation Antibody Pair Abnova 1 Set 834€
ASK
Pub
bs-4626R-Cy7Rabbit Anti-HE4 Epididymal secretory protein E4 Polyclonal Antibody, Cy7 conjugated Isotype: IgGSepax100ug Lyophilized268 bs-4626R-Cy7 Rabbit Anti-HE4 Epididymal secretory protein E4 Polyclonal Antibody, Cy7 conjugated Isotype: IgG Sepax 100ug Lyophilized 268€ Pub
228-10690-2Recombinant HCV NS5 Proteins Ray Biotech500961 228-10690-2 Recombinant HCV NS5 Proteins Ray Biotech 500 961€
ASK
Pub
bs-0437R-A555Rabbit Anti-Streptavidin SA protein Polyclonal Antibody, Alexa Fluor 555 conjugated,Isotype: IgGSepax100ug Lyophilized323 bs-0437R-A555 Rabbit Anti-Streptavidin SA protein Polyclonal Antibody, Alexa Fluor 555 conjugated,Isotype: IgG Sepax 100ug Lyophilized 323€ Pub
228-10624-1Recombinant HCV 22kDa Proteins Ray Biotech100353 228-10624-1 Recombinant HCV 22kDa Proteins Ray Biotech 100 353€ Pub
6531-100Protein L SepharoseBiovision100 ml6826 6531-100 Protein L Sepharose Biovision 100 ml 6826€
ASK
Pub
228-10546-3Native Human GHRH Proteins Ray Biotech5mg485 228-10546-3 Native Human GHRH Proteins Ray Biotech 5mg 485€
ASK
Pub
228-11448-3Recombinant Soy Bean P34 Protein, His-taggedRay Biotech1000 1876 228-11448-3 Recombinant Soy Bean P34 Protein, His-tagged Ray Biotech 1000 1876€
ASK
Pub
228-10477-2Recombinant Human FKBP4 Proteins Ray Biotech50205 228-10477-2 Recombinant Human FKBP4 Proteins Ray Biotech 50 205€ Pub
rAP-0292-10sEndogling (CD105), Sf9, (rHuman) recombinant proteins AngoiPro10.00 ug279 rAP-0292-10 sEndogling (CD105), Sf9, (rHuman) recombinant proteins AngoiPro 10.00 ug 279€ Pub
MD-14-0293PInfluenza A H5N1 (Avian) Hemagglutinin (Mid-molecule) Influenza A (H5N1) HA Peptide Proteins Ray Biotech50 452 MD-14-0293P Influenza A H5N1 (Avian) Hemagglutinin (Mid-molecule) Influenza A (H5N1) HA Peptide Proteins Ray Biotech 50 452€ Pub
024-15071Bone Morphogenetic Protein 13 (BMP 13), Human, recombinant Source Human bone morphogenetic protein 13 cDNA expressed in E.coli Appearance Lyophilized form with no additives (Sterile filtered) MoleculB-Bridge10ìg520.8 024-15071 Bone Morphogenetic Protein 13 (BMP 13), Human, recombinant Source Human bone morphogenetic protein 13 cDNA expressed in E.coli Appearance Lyophilized form with no additives (Sterile filtered) Molecul B-Bridge 10ìg 520.8€
ASK
Pub
228-10407-3Eptifibatide Proteins Ray Biotech100mg485 228-10407-3 Eptifibatide Proteins Ray Biotech 100mg 485€
ASK
Pub
rAP-0061-10SDF-1a (Mouse) recombinant proteins AngoiPro10.00 ug279 rAP-0061-10 SDF-1a (Mouse) recombinant proteins AngoiPro 10.00 ug 279€ Pub
ISASRbTPA-GF-FITCProteins and Antibodies Human and Animal Sheep Anti Rabbit tPA IgG fraction, FITC labeledInnovative Research INC1mg543 ISASRbTPA-GF-FITC Proteins and Antibodies Human and Animal Sheep Anti Rabbit tPA IgG fraction, FITC labeled Innovative Research INC 1mg 543€ Pub
228-10327-1Recombinant E. coli HSP40 DnaJ Proteins Ray Biotech20147 228-10327-1 Recombinant E. coli HSP40 DnaJ Proteins Ray Biotech 20 147€ Pub
MD-26-0001PNative Human APOA1 Proteins Ray Biotech1 mg309 MD-26-0001P Native Human APOA1 Proteins Ray Biotech 1 mg 309€ Pub
DS-01-0059Native Bovine Collagen III Proteins Ray Biotech10 mg292 DS-01-0059 Native Bovine Collagen III Proteins Ray Biotech 10 mg 292€ Pub
230-00223-50Recombinant Human PEDF SERPINF1 [from E. coli] Proteins Ray Biotech50 229 230-00223-50 Recombinant Human PEDF SERPINF1 [from E. coli] Proteins Ray Biotech 50 229€ Pub
228-10268-2Native Human C1q Proteins Ray Biotech1mg601 228-10268-2 Native Human C1q Proteins Ray Biotech 1mg 601€ Pub
KB-0111AccuPrep Genomic DNA Extraction KitBioneerProteinase K Powder, 2 ea X 25 mg101 KB-0111 AccuPrep Genomic DNA Extraction Kit Bioneer Proteinase K Powder, 2 ea X 25 mg 101€ Pub
228-11368-3Recombinant Human REG1-a Proteins Ray Biotech1mg0 228-11368-3 Recombinant Human REG1-a Proteins Ray Biotech 1mg 0€ Pub
Y062541Monoclonal Anti-Breast Cancer Resistance Protein produced in mouse AntibodyABM Goods100ul857 Y062541 Monoclonal Anti-Breast Cancer Resistance Protein produced in mouse Antibody ABM Goods 100ul 857€
ASK
Pub
DI0472BID & RHOA Protein Protein Interaction Antibody PairAbnova1 Set765 DI0472 BID & RHOA Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11295-3Recombinant Human PPM1G Proteins Ray Biotech1mg1658 228-11295-3 Recombinant Human PPM1G Proteins Ray Biotech 1mg 1658€
ASK
Pub
228-11111-3Recombinant Mouse IL-9 Proteins Ray Biotech1mg0 228-11111-3 Recombinant Mouse IL-9 Proteins Ray Biotech 1mg 0€
ASK
Pub
RD191022200ELISA Human , Clara Cell Protein Biovendor96 wells (1 kit)552 RD191022200 ELISA Human , Clara Cell Protein Biovendor 96 wells (1 kit) 552€ Pub
DI0309CRK & MAPK8 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0309 CRK & MAPK8 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11229-1Native Human PF-4 CXCL4 Proteins Ray Biotech5147 228-11229-1 Native Human PF-4 CXCL4 Proteins Ray Biotech 5 147€
ASK
Pub
228-10994-3Recombinant Human KIR3DL1 Proteins Ray Biotech1mg0 228-10994-3 Recombinant Human KIR3DL1 Proteins Ray Biotech 1mg 0€
ASK
Pub
mAP-0094Rat monoclonal anti mouse insulin-like growth factor binding protein 1 (IGFBP-1) Anti-Mouse antibodiesAngoiPro100.00 ug310 mAP-0094 Rat monoclonal anti mouse insulin-like growth factor binding protein 1 (IGFBP-1) Anti-Mouse antibodies AngoiPro 100.00 ug 310€ Pub
DI0147FADD & DAPK1 Protein Protein Interaction Antibody PairAbnova1 Set765 DI0147 FADD & DAPK1 Protein Protein Interaction Antibody Pair Abnova 1 Set 765€
ASK
Pub
228-11149-2Recombinant Human NAT6 Proteins Ray Biotech5353 228-11149-2 Recombinant Human NAT6 Proteins Ray Biotech 5 353€
ASK
Pub
228-10913-3Recombinant Human IIIL-28A IFN-lambda 2 Proteins Ray Biotech1mg2426 228-10913-3 Recombinant Human IIIL-28A IFN-lambda 2 Proteins Ray Biotech 1mg 2426€ Pub
K034-F1Hydrogen Peroxide Fluorescent Detection Kit (Two Plates)Arbor Assays2 x 96 well plate301 K034-F1 Hydrogen Peroxide Fluorescent Detection Kit (Two Plates) Arbor Assays 2 x 96 well plate 301€ Pub
CSB-EL002620BOBovine Bcl-2-like protein 2(BCL2L2) ELISA kit SpeciesBovineCusabio96T913 CSB-EL002620BO Bovine Bcl-2-like protein 2(BCL2L2) ELISA kit SpeciesBovine Cusabio 96T 913€
ASK
Pub
228-10823-3Recombinant Human IFN-beta 1b Proteins Ray Biotech1mg2426 228-10823-3 Recombinant Human IFN-beta 1b Proteins Ray Biotech 1mg 2426€ Pub
DS-MB-03400Mouse Anti-HPV 11 Protein E7 Antibodies Ray Biotech0.2 mg452 DS-MB-03400 Mouse Anti-HPV 11 Protein E7 Antibodies Ray Biotech 0.2 mg 452€ Pub
  Cat_Number Product name Supplier Quantity Price PDF Pub